Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count P-value
ependymoma 4679 1.3e-08
osteosarcoma 7950 6.0e-04
non primary Sjogren syndrome sicca 891 1.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.300 1.3e-08
non primary Sjogren syndrome sicca 1.500 1.2e-02
osteosarcoma -1.487 6.0e-04

 GO Process (1)

Gene RIF (2)

AA Sequence

MRRRLRLRRDALLTLLLGASLGLLLYAQRDGAAPTASAPRGRGRAAPRPTPGPRAFQLPDAGAAPPAYEG      1 - 70
DTPAPPTPTGPFDFARYLRAKDQRRFPLLINQPHKCRGDGAPGGRPDLLIAVKSVAEDFERRQAVRQTWG     71 - 140
AEGRVQGALVRRVFLLGVPRGAGSGGADEVGEGARTHWRALLRAESLAYADILLWAFDDTFFNLTLKEIH    141 - 210
FLAWASAFCPDVRFVFKGDADVFVNVGNLLEFLAPRDPAQDLLAGDVIVHARPIRTRASKYYIPEAVYGL    211 - 280
PAYPAYAGGGGFVLSGATLHRLAGACAQVELFPIDDVFLGMCLQRLRLTPEPHPAFRTFGIPQPSAAPHL    281 - 350
STFDPCFYRELVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS                      351 - 402
//

Text Mined References (5)

PMID Year Title