| Tbio | DNA damage-regulated autophagy modulator protein 2 |
Plays a role in the initiation of autophagy. In the retina, might be involved in the process of photoreceptor cells renewal and recycling to preserve visual function. Induces apoptotic cell death when coexpressed with DRAM1.
The protein encoded by this gene binds microtubule-associated protein 1 light chain 3 and is required for autophagy. Defects in this gene are a cause of retinal dystrophy. In addition, two microRNAs (microRNA 125b-1 and microRNA 144) can bind to the mRNA of this gene and produce the disease state. [provided by RefSeq, Mar 2017]
The protein encoded by this gene binds microtubule-associated protein 1 light chain 3 and is required for autophagy. Defects in this gene are a cause of retinal dystrophy. In addition, two microRNAs (microRNA 125b-1 and microRNA 144) can bind to the mRNA of this gene and produce the disease state. [provided by RefSeq, Mar 2017]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Cone-Rod Dystrophy 21 | 1 | 0.0 | 0.0 |
| Disease | Target Count |
|---|---|
| Retinitis Pigmentosa | 226 |
| Disease | Target Count | P-value |
|---|---|---|
| glioblastoma multiforme | 142 | 3.7e-20 |
| astrocytoma | 1146 | 1.9e-14 |
| ovarian cancer | 8520 | 6.6e-06 |
| posterior fossa group A ependymoma | 468 | 7.1e-06 |
| sonic hedgehog group medulloblastoma | 467 | 2.5e-04 |
| osteosarcoma | 7950 | 3.6e-04 |
| pediatric high grade glioma | 1064 | 7.7e-04 |
| Astrocytoma, Pilocytic | 3081 | 9.6e-04 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Fundus dystrophy | 83 | 3.555 | 1.8 |
| Disease | Target Count |
|---|---|
| cone-rod dystrophy | 59 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytoma | 1.100 | 1.9e-14 |
| Astrocytoma, Pilocytic | 1.100 | 9.6e-04 |
| glioblastoma multiforme | 1.200 | 3.7e-20 |
| osteosarcoma | -1.723 | 3.6e-04 |
| ovarian cancer | -1.500 | 6.6e-06 |
| pediatric high grade glioma | 1.100 | 7.7e-04 |
| posterior fossa group A ependymoma | 1.100 | 7.1e-06 |
| sonic hedgehog group medulloblastoma | 1.700 | 2.5e-04 |
| Species | Source | Disease |
|---|---|---|
| OMA EggNOG | ||
| Inparanoid OMA | ||
| OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG |
MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIAT 1 - 70 IYVRYKQVHALSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAAHVSGAVLTFGMGSLYMFVQT 71 - 140 ILSYQMQPKIHGKQVFWIRLLLVIWCGVSALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTA 141 - 210 AEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI 211 - 266 //
