Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.65
PubTator Score 7.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cone-Rod Dystrophy 21 1 0.0 0.0
Disease Target Count
Retinitis Pigmentosa 226
Disease Target Count Z-score Confidence
Fundus dystrophy 83 3.555 1.8
Disease Target Count
cone-rod dystrophy 59

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 1.9e-14
Astrocytoma, Pilocytic 1.100 9.6e-04
glioblastoma multiforme 1.200 3.7e-20
osteosarcoma -1.723 3.6e-04
ovarian cancer -1.500 6.6e-06
pediatric high grade glioma 1.100 7.7e-04
posterior fossa group A ependymoma 1.100 7.1e-06
sonic hedgehog group medulloblastoma 1.700 2.5e-04

Gene RIF (8)

AA Sequence

MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIAT      1 - 70
IYVRYKQVHALSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAAHVSGAVLTFGMGSLYMFVQT     71 - 140
ILSYQMQPKIHGKQVFWIRLLLVIWCGVSALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTA    141 - 210
AEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI                  211 - 266
//

Text Mined References (17)

PMID Year Title