1. Home
  2. Targets
  3. DNA damage-regulated autophagy modulator protein 2

Tbio DNA damage-regulated autophagy modulator protein 2

Plays a role in the initiation of autophagy. In the retina, might be involved in the process of photoreceptor cells renewal and recycling to preserve visual function. Induces apoptotic cell death when coexpressed with DRAM1.

 Comments

Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.61
PubTator Score 7.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Retinal Dystrophies 5
Disease Target Count P-value
glioblastoma multiforme 347 3.65222174106478E-20
astrocytoma 1493 1.92858588623615E-14
ovarian cancer 8492 4.62698351209576E-7
pilocytic astrocytoma 3086 1.4678731765899E-5
posterior fossa group B ependymoma 1530 8.58384779521712E-5
sonic hedgehog group medulloblastoma 1482 2.47427266912337E-4
osteosarcoma 7933 3.58643276491414E-4
pediatric high grade glioma 2712 7.73830036206578E-4
Disease Target Count Z-score Confidence
Fundus dystrophy 77 3.567 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 0.000
glioblastoma multiforme 1.200 0.000
osteosarcoma -1.723 0.000
pediatric high grade glioma 1.100 0.001
pilocytic astrocytoma 1.400 0.000
posterior fossa group B ependymoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.700 0.000
ovarian cancer 1.900 0.000

Synonym

Accession Q6UX65 B3SUG9 Q4VWF6 Q86VD3 Q8NBQ4
Symbols CORD21
PRO180
TMEM77
WWFQ154

Gene

DRAM2

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 GO Component (8)

 GO Process (5)

 Compartment GO Term (39)

See all...

 HCA RNA Cell Line (56)

See all...

 UniProt Keyword (11)

See all...

Gene RIF (7)

PMID Text
26720460 Recessive variants in DRAM2, an autophagy regulator gene, have been recently identified as a cause of retinal dystrophy with early macular involvement
26509668 Genetic variants on chromosome 1p13.3 near the damage-regulated autophagy modulator 2 gene DRAM2 associated with Non-ST Elevation Myocardial Infarction (rs656843; odds ratio 1.57, P = 3.11 x 10(-10)) in the case-control analysis.
25983245 Biallelic mutations in the autophagy regulator DRAM2 cause retinal dystrophy with early macular involvement.
21584698 The expression of damage-regulated autophagy modulator 2 (DRAM2) contributes to autophagy induction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19895784 reduced expression of DRAM2 may contribute to enhanced cell survival in tumor cells.
19556885 DRAM2 is different from DRAM as it not induced by p53 or p73. DRAM2 is also a lysosomal protein, its overexpression does not modulate autophagy.

AA Sequence 

MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIAT      1 - 70
IYVRYKQVHALSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAAHVSGAVLTFGMGSLYMFVQT     71 - 140
ILSYQMQPKIHGKQVFWIRLLLVIWCGVSALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTA    141 - 210
AEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI                  211 - 266
//

Text Mined References (14)

PMID Year Title
26720460 2015 Disease Expression in Autosomal Recessive Retinal Dystrophy Associated With Mutations in the DRAM2 Gene.
26509668 2015 Genetic Variants on Chromosome 1p13.3 Are Associated with Non-ST Elevation Myocardial Infarction and the Expression of DRAM2 in the Finnish Population.
25983245 2015 Biallelic mutations in the autophagy regulator DRAM2 cause retinal dystrophy with early macular involvement.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21584698 2012 The expression of damage-regulated autophagy modulator 2 (DRAM2) contributes to autophagy induction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19895784 2009 Reduced expression of DRAM2/TMEM77 in tumor cells interferes with cell death.
19556885 2009 Analysis of DRAM-related proteins reveals evolutionarily conserved and divergent roles in the control of autophagy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...