Tbio | DNA damage-regulated autophagy modulator protein 2 |
Plays a role in the initiation of autophagy. In the retina, might be involved in the process of photoreceptor cells renewal and recycling to preserve visual function. Induces apoptotic cell death when coexpressed with DRAM1.
Comments
Disease | Target Count |
---|---|
Retinal Dystrophies | 5 |
Disease | Target Count | P-value |
---|---|---|
glioblastoma multiforme | 347 | 3.65222174106478E-20 |
astrocytoma | 1493 | 1.92858588623615E-14 |
ovarian cancer | 8492 | 4.62698351209576E-7 |
pilocytic astrocytoma | 3086 | 1.4678731765899E-5 |
posterior fossa group B ependymoma | 1530 | 8.58384779521712E-5 |
sonic hedgehog group medulloblastoma | 1482 | 2.47427266912337E-4 |
osteosarcoma | 7933 | 3.58643276491414E-4 |
pediatric high grade glioma | 2712 | 7.73830036206578E-4 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Fundus dystrophy | 77 | 3.567 | 1.8 |
Disease | Target Count |
---|---|
Cone-Rod Dystrophy 21 | 1 |
cone-rod dystrophy | 60 |
Disease | log2 FC | p |
---|---|---|
astrocytoma | 1.100 | 0.000 |
glioblastoma multiforme | 1.200 | 0.000 |
osteosarcoma | -1.723 | 0.000 |
pediatric high grade glioma | 1.100 | 0.001 |
pilocytic astrocytoma | 1.400 | 0.000 |
posterior fossa group B ependymoma | 1.200 | 0.000 |
sonic hedgehog group medulloblastoma | 1.700 | 0.000 |
ovarian cancer | 1.900 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG |
PMID | Text |
---|---|
26720460 | Recessive variants in DRAM2, an autophagy regulator gene, have been recently identified as a cause of retinal dystrophy with early macular involvement |
26509668 | Genetic variants on chromosome 1p13.3 near the damage-regulated autophagy modulator 2 gene DRAM2 associated with Non-ST Elevation Myocardial Infarction (rs656843; odds ratio 1.57, P = 3.11 x 10(-10)) in the case-control analysis. |
25983245 | Biallelic mutations in the autophagy regulator DRAM2 cause retinal dystrophy with early macular involvement. |
21584698 | The expression of damage-regulated autophagy modulator 2 (DRAM2) contributes to autophagy induction. |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
19895784 | reduced expression of DRAM2 may contribute to enhanced cell survival in tumor cells. |
19556885 | DRAM2 is different from DRAM as it not induced by p53 or p73. DRAM2 is also a lysosomal protein, its overexpression does not modulate autophagy. |
MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIAT 1 - 70 IYVRYKQVHALSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAAHVSGAVLTFGMGSLYMFVQT 71 - 140 ILSYQMQPKIHGKQVFWIRLLLVIWCGVSALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTA 141 - 210 AEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI 211 - 266 //
PMID | Year | Title |
---|---|---|
26720460 | 2015 | Disease Expression in Autosomal Recessive Retinal Dystrophy Associated With Mutations in the DRAM2 Gene. |
26509668 | 2015 | Genetic Variants on Chromosome 1p13.3 Are Associated with Non-ST Elevation Myocardial Infarction and the Expression of DRAM2 in the Finnish Population. |
25983245 | 2015 | Biallelic mutations in the autophagy regulator DRAM2 cause retinal dystrophy with early macular involvement. |
22001757 | 2011 | Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma. |
21584698 | 2012 | The expression of damage-regulated autophagy modulator 2 (DRAM2) contributes to autophagy induction. |
20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
19895784 | 2009 | Reduced expression of DRAM2/TMEM77 in tumor cells interferes with cell death. |
19556885 | 2009 | Analysis of DRAM-related proteins reveals evolutionarily conserved and divergent roles in the control of autophagy. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. |
More... |