Property Summary

NCBI Gene PubMed Count 4
PubMed Score 27.99
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.53354769276989E-18
lung adenocarcinoma 2714 8.37127589215151E-12
posterior fossa group A ependymoma 1511 5.23602631286204E-11
ovarian cancer 8492 9.0235686914969E-9
adult high grade glioma 2148 1.72689028108162E-7
ulcerative colitis 2087 2.82678669863848E-7
pilocytic astrocytoma 3086 7.67787988275188E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 5.37487336179037E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00161028013967881
glioblastoma 5572 0.00315710690294296
non diabetic and post-ischemic heart failure 200 0.0155833254504155
active Crohn's disease 918 0.0320525824553959
atypical teratoid / rhabdoid tumor 4369 0.0414653290446266

Expression

Synonym

Accession Q6UX53 A8K247 Q8WUI1
Symbols ALDI

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

MDILVPLLQLLVLLLTLPLHLMALLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASG      1 - 70
KVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDV     71 - 140
VVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWK    141 - 210
DLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK                                        211 - 244
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17004324 2006 Identification and characterization of associated with lipid droplet protein 1: A novel membrane-associated protein that resides on hepatic lipid droplets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.