Property Summary

NCBI Gene PubMed Count 4
PubMed Score 33.91
PubTator Score 7.50

Knowledge Summary


No data available


  Differential Expression (13)

Disease log2 FC p
active Crohn's disease -1.520 3.2e-02
adult high grade glioma 3.300 1.7e-07
Astrocytoma, Pilocytic 2.000 7.6e-05
atypical teratoid / rhabdoid tumor 1.500 4.1e-02
ependymoma 1.900 3.7e-07
glioblastoma 2.600 6.8e-05
intraductal papillary-mucinous neoplasm ... 2.000 1.6e-03
lung adenocarcinoma 1.100 8.4e-12
non diabetic and post-ischemic heart fai... -1.300 1.6e-02
ovarian cancer 2.100 9.0e-09
pancreatic ductal adenocarcinoma liver m... -2.546 5.4e-04
psoriasis -2.600 1.5e-18
ulcerative colitis -2.200 2.8e-07

AA Sequence

DLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK                                        211 - 244

Text Mined References (6)

PMID Year Title