Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.8e-10
ovarian cancer 8520 2.5e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -5.213 4.8e-10
ovarian cancer -2.000 2.5e-04

Gene RIF (1)

AA Sequence

MGLPGLFCLAVLAASSFSKAREEEITPVVSIAYKVLEVFPKGRWVLITCCAPQPPPPITYSLCGTKNIKV      1 - 70
AKKVVKTHEPASFNLNVTLKSSPDLLTYFCWASSTSGAHVDSARLQMHWELWSKPVSELRANFTLQDRGA     71 - 140
GPRVEMICQASSGSPPITNSLIGKDGQVHLQQRPCHRQPANFSFLPSQTSDWFWCQAANNANVQHSALTV    141 - 210
VPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM                   211 - 265
//

Text Mined References (5)

PMID Year Title