Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.97
PubTator Score 0.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.37837754177212E-36
lung adenocarcinoma 2714 3.3076014779608E-17
breast carcinoma 1614 1.64329966393745E-14
Breast cancer 3099 1.4791467095303E-12
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.02760581544504E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 1.12478881472956E-6
psoriasis 6685 1.0364088576542E-5
cystic fibrosis 1670 4.54197555069301E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.31585883447752E-5
pancreatic cancer 2300 6.49366682414321E-5
Atopic dermatitis 944 0.00410260272978663
ovarian cancer 8492 0.00537936286369271
interstitial cystitis 2299 0.00934319092097156
invasive ductal carcinoma 2950 0.0158118623997551
gastric carcinoma 832 0.0182305554151828
primary pancreatic ductal adenocarcinoma 1271 0.0202265419221076
astrocytic glioma 2241 0.0326746468296239
atypical teratoid/rhabdoid tumor 1095 0.0424748768139163
Endometriosis 535 0.0460287759672073
medulloblastoma, large-cell 6234 0.0490671672605544

Expression

Gene RIF (3)

PMID Text
26630010 Data show FAM150B, which was named as augmentor-alpha (AUG-alpha), binds and activtes both anaplastic lymphoma kinase (ALK) and tyrosine kinase (LTK).
26418745 In conclusion, these data show that ALK is robustly activated by the FAM150A/B ligands.
25331893 Only two related secreted factors, FAM150A and FAM150B (family with sequence similarity 150 member A and member B), stimulated LTK phosphorylation.

AA Sequence

MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGR      1 - 70
AEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTR     71 - 140
LAVSPVCMEDKQ                                                              141 - 152
//

Text Mined References (6)

PMID Year Title
26630010 2015 Augmentor ? and ? (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.
26418745 2015 FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.
25331893 2014 Deorphanization of the human leukocyte tyrosine kinase (LTK) receptor by a signaling screen of the extracellular proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
11181995 2001 The sequence of the human genome.