Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.97
PubTator Score 0.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26630010 Data show FAM150B, which was named as augmentor-alpha (AUG-alpha), binds and activtes both anaplastic lymphoma kinase (ALK) and tyrosine kinase (LTK).
26418745 In conclusion, these data show that ALK is robustly activated by the FAM150A/B ligands.
25331893 Only two related secreted factors, FAM150A and FAM150B (family with sequence similarity 150 member A and member B), stimulated LTK phosphorylation.

AA Sequence

MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGR      1 - 70
AEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTR     71 - 140
LAVSPVCMEDKQ                                                              141 - 152
//

Text Mined References (6)

PMID Year Title
26630010 2015 Augmentor ? and ? (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.
26418745 2015 FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.
25331893 2014 Deorphanization of the human leukocyte tyrosine kinase (LTK) receptor by a signaling screen of the extracellular proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
11181995 2001 The sequence of the human genome.