Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.54
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.300 6.9e-08
medulloblastoma, large-cell -1.500 1.0e-02
nasopharyngeal carcinoma -1.100 2.7e-05
tuberculosis 1.600 2.8e-07

Gene RIF (2)

AA Sequence

MGRVSGLVPSRFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAALSVTLGLFAVELAG      1 - 70
FLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLKKKPF     71 - 140
//

Text Mined References (11)

PMID Year Title