Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $60,250.43
PubMed Score 26.95
PubTator Score 5.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (2)

PMID Text
25407797 AMTN has a direct influence on biomineralization by promoting hydroxyapatite mineralization.
25158173 proinflammatory cytokines induce Amelotin gene transcription and a role for Amelotin in gingival inflammation

AA Sequence

MRSTILLFCLLGSTRSLPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLN      1 - 70
PAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTS     71 - 140
QAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ     141 - 209
//

Text Mined References (12)

PMID Year Title
25789606 2015 A secretory kinase complex regulates extracellular protein phosphorylation.
25407797 2015 The enamel protein amelotin is a promoter of hydroxyapatite mineralization.
25158173 2014 Transcriptional regulation of amelotin gene by proinflammatory cytokines in gingival fibroblasts.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16787391 2006 Cloning of rat amelotin and localization of the protein to the basal lamina of maturation stage ameloblasts and junctional epithelium.
16304441 2005 Amelotin--a Novel Secreted, Ameloblast-specific Protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...