Property Summary

NCBI Gene PubMed Count 13
PubMed Score 27.51
PubTator Score 5.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Amelogenesis imperfecta 29 5.037 2.5
Disease Target Count Z-score Confidence
Dental fluorosis 20 3.382 1.7
Exotropia 35 3.354 1.7

Gene RIF (4)

AA Sequence

MRSTILLFCLLGSTRSLPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLN      1 - 70
PAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTS     71 - 140
QAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ     141 - 209
//

Text Mined References (14)

PMID Year Title