Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q6UX34
Symbols UNQ830
ASCL830
C2orf82

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MASCLALRMALLLVSGVLAPAVLTDDVPQEPVPTLWNEPAELPSGEGPVESTSPGREPVDTGPPAPTVAP      1 - 70
GPEDSTAQERLDQGGGSLGPGAIAAIVIAALLATCVVLALVVVALRKFSAS                        71 - 121
//

Text Mined References (9)

PMID Year Title