Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.40
PubTator Score 10.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 5.8e-03

Gene RIF (7)

AA Sequence

MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQ      1 - 70
EQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI     71 - 140
FSCISILLLFLSVFIIYRCSQHSSSSEESTKRTSHSKLPEQEAAEADLSNMERVSLSTADPQGVTYAELS    141 - 210
TSALSEAASDTTQEPPGSHEYAALKV                                                211 - 236
//

Text Mined References (14)

PMID Year Title