Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.62
PubTator Score 10.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 0.006

Gene RIF (5)

PMID Text
26760041 VSTM1-v2 might be a biomarker of rheumatoid arthritis (RA) and a novel factor in the pathogenesis of RA.
25887911 we report a potential leukocyte differentiation antigen gene VSTM1 (V-set and transmembrane domain-containing 1) that was downregulated in bone marrow cells from leukemia patients and exhibited a higher degree of promoter methylation
24205237 Signaling via the inhibitory receptor SIRL-1 was induced by ligation with anti-SIRL-1 specific antibodies.
23436183 SIRL-1 negatively regulates the oxidative burst in human phagocytes.
20375307 Signal inhibitory receptor on leukocytes-1 is a member of immunoglobulin superfamily ITIM; expressed by myeloid but not lymphoid cells; requires both of its ITIMs for full inhibition of Fc epsilon receptor type I-mediated mast cell degranulation.

AA Sequence

MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQ      1 - 70
EQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI     71 - 140
FSCISILLLFLSVFIIYRCSQHSSSSEESTKRTSHSKLPEQEAAEADLSNMERVSLSTADPQGVTYAELS    141 - 210
TSALSEAASDTTQEPPGSHEYAALKV                                                211 - 236
//

Text Mined References (12)

PMID Year Title
26760041 2016 Expression of VSTM1-v2 Is Increased in Peripheral Blood Mononuclear Cells from Patients with Rheumatoid Arthritis and Is Correlated with Disease Activity.
25887911 2015 VSTM-v1, a potential myeloid differentiation antigen that is downregulated in bone marrow cells from myeloid leukemia patients.
24205237 2013 Ligation of signal inhibitory receptor on leukocytes-1 suppresses the release of neutrophil extracellular traps in systemic lupus erythematosus.
23436183 2013 Signal inhibitory receptor on leukocytes-1 (SIRL-1) negatively regulates the oxidative burst in human phagocytes.
22960280 VSTM1-v2, a novel soluble glycoprotein, promotes the differentiation and activation of Th17 cells.
20375307 2010 Signal inhibitory receptor on leukocytes-1 is a novel functional inhibitory immune receptor expressed on human phagocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...