Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.99
PubTator Score 8.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 0.034
osteosarcoma 1.372 0.037
glioblastoma 1.300 0.003
tuberculosis -1.700 0.000
intraductal papillary-mucinous adenoma (... -2.300 0.000
intraductal papillary-mucinous carcinoma... -2.500 0.000
pilocytic astrocytoma 1.500 0.000
lung adenocarcinoma -1.200 0.000
Breast cancer -2.000 0.000
spina bifida -2.241 0.048
ovarian cancer -1.600 0.000
pituitary cancer -1.600 0.000

Synonym

Accession Q6UX15 A6NJB0 B4DJU0 Q8TAY8 Q96NC5 Q96NF3
Symbols

Gene

Gene RIF (3)

PMID Text
26410531 Renal biopsy samples from patients with glomerulonephritis showed high expression of LAYN in tubular epithelial cells.
25150153 results indicate that LAYN would be involved in the enhancement of inflammation and degradation of cartilage in joint diseases such as RA and OA
23048036 Hyaluronan and layilin mediate loss of airway epithelial barrier function induced by cigarette smoke by decreasing E-cadherin.

AA Sequence

MRPGTALQAVLLAVLLVGLRAATGRLLSASDLDLRGGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAKEA      1 - 70
CRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACQDLYAWTDGSISQFRNWYV     71 - 140
DEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSDEKPAVPSREAEGEETELTTPVL    141 - 210
PEETQEEDAKKTFKESREAALNLAYILIPSIPLLLLLVVTTVVCWVWICRKRKREQPDPSTKKQHTIWPS    211 - 280
PHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFVTLVSVE    281 - 350
SGFVTNDIYEFSPDQMGRSKESGWVENEIYGY                                          351 - 382
//

Text Mined References (14)

PMID Year Title
26410531 2015 Roles of layilin in TNF-?-induced epithelial-mesenchymal transformation of renal tubular epithelial cells.
25150153 2014 Secretion of inflammatory factors from chondrocytes by layilin signaling.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23048036 2012 Hyaluronan and layilin mediate loss of airway epithelial barrier function induced by cigarette smoke by decreasing E-cadherin.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15913605 2005 Layilin, a cell surface hyaluronan receptor, interacts with merlin and radixin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...