Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.4e-02
non-small cell lung cancer 1.184 9.6e-16
osteosarcoma -3.799 1.7e-08
ovarian cancer 1.200 1.6e-05

AA Sequence

MEALLLGAGLLLGAYVLVYYNLVKAPPCGGMGNLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSQ      1 - 70
ERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCGRTREAFNLLLR     71 - 140
VNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARE    141 - 210
LANQLEATGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGR    211 - 280
YFANCHVEEVPPAARDDRAAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPY    281 - 350
PSPQSSPDLSKMTHRIQAKVEPEIQLS                                               351 - 377
//

Text Mined References (7)

PMID Year Title