Property Summary

NCBI Gene PubMed Count 50
Grant Count 74
R01 Count 43
Funding $5,436,750.75
PubMed Score 52.81
PubTator Score 149.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Barrett's esophagus 4.200 0.036
esophageal adenocarcinoma 5.100 0.018
osteosarcoma -5.891 0.000
active Crohn's disease 1.374 0.021
ulcerative colitis 2.200 0.000
pancreatic cancer 1.500 0.044
lung adenocarcinoma 1.500 0.005
primary Sjogren syndrome 2.500 0.000
Breast cancer -3.900 0.000
gastric carcinoma 6.700 0.038

Synonym

Accession Q6UX06 O95362 Q5VWG0 Q86T22 OLM4
Symbols GC1
OLM4
OlfD
GW112
hGC-1
hOLfD
UNQ362
bA209J19.1

Gene

PANTHER Protein Class (1)

Gene RIF (33)

PMID Text
26581960 olfactomedin 4 appears to play a critical role in regulating progression of prostate cancer, and has potential as a new biomarker for prostate cancer.
26398045 suppression of OLFM4 expression may be a promising strategy in the development of novel cancer therapeutic drugs
26303970 Study demonstrates that epigenetic silencing of OLFM4 enhances gastric cancer cell invasion via activation of FAK signaling.
26162090 Patients with an OLFM4 gene expression level above -7.5 were 6 times more likely to develop severe disease, after correction for age at hospitalization and gestational age.
26070873 findings suggest that OLFM4 is not only involved in early stages of gastric carcinogenesis but also a useful prognostic marker for advanced gastric cancer
26011333 High expression of GW112 in colorectal cancer tissues and reduced expression of GRIM-19 in colorectal cancer tissues may be associated with abnormal proliferation of cancer cells.
25771901 although low OLFM4 expression is not an independent prognostic biomarker, it might indicate worse prognosis for smoking patients with non-small cell lung cancer
25400027 OLM4 expression is increased in the early stages of gastric, colorectal, and pancreatic cancer initiation.
25333937 Using a human vaginal epithelial cell line, the expression of mucin 5 subtype B and olfactomedin-4 were down-regulated in response to N9, suggesting these markers could apply to humans
24495253 Impairment of ERalpha signal-mediated OLFM4 expression promoted the malignant progression of endometrioid adenocarcinoma.
More...

AA Sequence

MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLF      1 - 70
SNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVR     71 - 140
IDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVL    141 - 210
AIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSP    211 - 280
QHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIAR    281 - 350
VNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNT    351 - 420
WYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKL    421 - 490
YVYNDGYLLNYDLSVLQKPQ                                                      491 - 510
//

Text Mined References (54)

PMID Year Title
26581960 2015 Olfactomedin 4 deficiency promotes prostate neoplastic progression and is associated with upregulation of the hedgehog-signaling pathway.
26398045 2015 A quantitative proteomics study on olfactomedin 4 in the development of gastric cancer.
26303970 2015 Epigenetic silencing of olfactomedin-4 enhances gastric cancer cell invasion via activation of focal adhesion kinase signaling.
26162090 2015 Olfactomedin 4 Serves as a Marker for Disease Severity in Pediatric Respiratory Syncytial Virus (RSV) Infection.
26070873 2015 Olfactomedin-related proteins 4 (OLFM4) expression is involved in early gastric carcinogenesis and of prognostic significance in advanced gastric cancer.
26011333 Expression of GW112 and GRIM-19 in colorectal cancer tissues.
25771901 2015 Low expression of olfactomedin 4 correlates with poor prognosis in smoking patients with non-small cell lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25400027 2015 Olfactomedin-4 is a candidate biomarker of solid gastric, colorectal, pancreatic, head and neck, and prostate cancers.
25333937 2014 New candidate biomarkers in the female genital tract to evaluate microbicide toxicity.
More...