Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.14
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.55359369943449E-6
medulloblastoma, large-cell 6234 5.69799135264838E-4
tuberculosis 1563 8.507727950608E-4
glioblastoma 5572 0.00392254967266581
atypical teratoid / rhabdoid tumor 4369 0.00433216730358315
adult high grade glioma 2148 0.00550184650540387
medulloblastoma 1524 0.005928344742634
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00787344066925539
Rheumatoid Arthritis 1171 0.0485812094251829

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.049
atypical teratoid / rhabdoid tumor -1.100 0.004
glioblastoma -1.400 0.004
medulloblastoma -1.100 0.006
medulloblastoma, large-cell -1.400 0.001
tuberculosis 1.100 0.001
intraductal papillary-mucinous adenoma (... 1.300 0.008
adult high grade glioma -1.400 0.006
ovarian cancer 2.400 0.000

Synonym

Accession Q6UX04 O60529 O60530 Q96EM3 PPIase CWC27
Symbols NY-CO-10
SDCCAG10
SDCCAG-10

Gene

PANTHER Protein Class (1)

PDB

2HQ6   4R3E  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

 MGI Term (1)

Gene RIF (2)

PMID Text
25478830 The crystal structure of a relatively protease-resistant N-terminal fragment of human Cwc27 containing the cyclophilin-type peptidyl-prolyl cis-trans isomerase domain was determined at 2.0 A resolution.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTG      1 - 70
TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYN     71 - 140
MLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEE    141 - 210
AEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNL    211 - 280
MRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAKQKKVENAAKQAEKRSEEEE    281 - 350
APPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWM    351 - 420
SHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR                      421 - 472
//

Text Mined References (16)

PMID Year Title
25478830 2014 Structure and evolution of the spliceosomal peptidyl-prolyl cis-trans isomerase Cwc27.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19941820 2009 The evolutionarily conserved core design of the catalytic activation step of the yeast spliceosome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...