Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.14
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.049
atypical teratoid / rhabdoid tumor -1.100 0.004
glioblastoma -1.400 0.004
medulloblastoma -1.100 0.006
medulloblastoma, large-cell -1.400 0.001
tuberculosis 1.100 0.001
intraductal papillary-mucinous adenoma (... 1.300 0.008
adult high grade glioma -1.400 0.006
ovarian cancer 2.400 0.000

Synonym

Accession Q6UX04 O60529 O60530 Q96EM3 PPIase CWC27
Symbols NY-CO-10
SDCCAG10
SDCCAG-10

Gene

PANTHER Protein Class (1)

PDB

2HQ6   4R3E  

Gene RIF (2)

PMID Text
25478830 The crystal structure of a relatively protease-resistant N-terminal fragment of human Cwc27 containing the cyclophilin-type peptidyl-prolyl cis-trans isomerase domain was determined at 2.0 A resolution.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTG      1 - 70
TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYN     71 - 140
MLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEE    141 - 210
AEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNL    211 - 280
MRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAKQKKVENAAKQAEKRSEEEE    281 - 350
APPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWM    351 - 420
SHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR                      421 - 472
//

Text Mined References (16)

PMID Year Title
25478830 2014 Structure and evolution of the spliceosomal peptidyl-prolyl cis-trans isomerase Cwc27.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19941820 2009 The evolutionarily conserved core design of the catalytic activation step of the yeast spliceosome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...