Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.71
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 5.5e-03
atypical teratoid / rhabdoid tumor -1.100 4.3e-03
glioblastoma -1.400 3.9e-03
intraductal papillary-mucinous adenoma (... 1.300 7.9e-03
medulloblastoma -1.100 5.9e-03
medulloblastoma, large-cell -1.400 5.7e-04
ovarian cancer 2.400 2.6e-06
Rheumatoid arthritis 1.200 4.9e-02
tuberculosis 1.100 8.5e-04

Gene RIF (4)

AA Sequence

MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTG      1 - 70
TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYN     71 - 140
MLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEE    141 - 210
AEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNL    211 - 280
MRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAKQKKVENAAKQAEKRSEEEE    281 - 350
APPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWM    351 - 420
SHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR                      421 - 472
//

Text Mined References (18)

PMID Year Title