Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.92
PubTator Score 6.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 3.0e-07
Disease Target Count Z-score Confidence
Ocular hypertension 42 3.155 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -2.100 3.0e-07

Gene RIF (4)

AA Sequence

MEAPDYEVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDDEDATVNKIALELCTF      1 - 70
TLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGF     71 - 140
AGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDKNKANRESLYDFWEYYLPYLYSCISFLGVLLLL    141 - 210
VCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQTQ    211 - 280
RVLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGS    281 - 350
FGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDL    351 - 420
LGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ     421 - 489
//

Text Mined References (16)

PMID Year Title