Property Summary

NCBI Gene PubMed Count 20
Grant Count 11
R01 Count 11
Funding $498,015.96
PubMed Score 4.54
PubTator Score 7.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (12)

PMID Text
26778126 Demonstrate a mechanism involving IR-induced phosphorylation and dimerization of the BRCT/Abraxas complex for regulating Abraxas-mediated recruitment of BRCA1 in response to IR.
22357538 The recurrent Abraxas c.1082G>A mutation connects to breast cancer predisposition.
21529986 low expression correlates with better response to chemotherapy and longer survival in patients with advanced non small-cell lung cancer
19415121 examined RAP80 and Abraxas expression and their effect on treatment outcome in non-small-cell lung cancer
18695986 it seems unlikely that moderate to highly penetrant alleles of either RAP80 or Abraxas, confer a significantly high relative risk of breast cancer.
18695986 Observational study of gene-disease association. (HuGE Navigator)
18270812 Mutational analysis in 168 multiple-case breast/ovarian cancer families, negative for mutations in BRCA1 or BRCA2, suggests that CCDC98 does not play an important role as a high penetrance breast cancer susceptibility gene.
18270812 Observational study of gene-disease association. (HuGE Navigator)
18077395 the human Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage
17643122 CCDC98 is a mediator of BRCA1 function involved in the mammalian DNA damage response.
More...

AA Sequence

MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQL      1 - 70
FSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSII     71 - 140
TESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLK    141 - 210
EVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFL    211 - 280
CQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALD    281 - 350
LDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF               351 - 409
//

Text Mined References (29)

PMID Year Title
26778126 2016 Structure of BRCA1-BRCT/Abraxas Complex Reveals Phosphorylation-Dependent BRCT Dimerization at DNA Damage Sites.
25105795 2015 Mislocalization of BRCA1-complex due to ABRAXAS Arg361Gln mutation.
24316840 2013 Preliminary crystallographic studies of BRCA1 BRCT-ABRAXAS complex.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22357538 2012 Breast cancer-associated Abraxas mutation disrupts nuclear localization and DNA damage response functions.
21529986 2011 Tubulin, BRCA1, ERCC1, Abraxas, RAP80 mRNA expression, p53/p21 immunohistochemistry and clinical outcome in patients with advanced non small-cell lung cancer receiving first-line platinum-gemcitabine chemotherapy.
21437268 2011 A genome-wide association study of upper aerodigestive tract cancers conducted within the INHANCE consortium.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...