Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.77
PubTator Score 7.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.200 2.1e-02
atypical teratoid / rhabdoid tumor 1.500 4.5e-05
Breast cancer -1.200 4.4e-06
diabetes mellitus -1.300 2.2e-03
ependymoma 1.400 2.0e-07
group 3 medulloblastoma 1.100 3.3e-02
head and neck cancer -1.100 2.4e-02
medulloblastoma, large-cell 1.200 4.7e-03
osteosarcoma -1.252 4.6e-03
ovarian cancer -2.000 1.4e-06
pituitary cancer 1.200 6.9e-05
primitive neuroectodermal tumor 1.300 8.4e-04

Gene RIF (14)

AA Sequence

MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQL      1 - 70
FSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSII     71 - 140
TESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLK    141 - 210
EVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFL    211 - 280
CQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALD    281 - 350
LDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF               351 - 409
//

Text Mined References (31)

PMID Year Title