Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.06
PubTator Score 2.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.1956150751642E-23
breast carcinoma 1614 1.62599423270661E-14
non-small cell lung cancer 2798 1.74190431484436E-13
posterior fossa group A ependymoma 1511 2.35513439931463E-12
lung carcinoma 2844 3.80088110361558E-10
lung adenocarcinoma 2714 2.9716748790593E-9
lung cancer 4473 7.10982062583668E-5
cystic fibrosis 1670 9.16533072311207E-5
adrenocortical carcinoma 1427 2.25796069148689E-4
sonic hedgehog group medulloblastoma 1482 2.3552786535109E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.11849606551648E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00121052051963218
Atopic dermatitis 944 0.00122073029156782
psoriasis 6685 0.00127925591476594
invasive ductal carcinoma 2950 0.00151674443936527
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00538388126742483
atypical teratoid / rhabdoid tumor 4369 0.00837787279728934
ductal carcinoma in situ 1745 0.021011498522272
Disease Target Count Z-score Confidence
Endometritis 21 3.926 2.0

Expression

Synonym

Accession Q6UWY5 B4DP03 Q569G4
Symbols UNQ564

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
18708057 These findings suggest that hOLFML1 may play a significant role in the regulation of cell proliferation in vitro.

AA Sequence

MMVALRGASALLVLFLAAFLPPPQCTQDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVM      1 - 70
LGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIESEDKTLAEMLLQEAEEEKKIRTLLNAS     71 - 140
CDNMLMGIKSLKIVKKMMDTHGSWMKDAVYNSPKVYLLIGSRNNTVWEFANIRAFMEDNTKPAPRKQILT    141 - 210
LSWQGTGQVIYKGFLFFHNQATSNEIIKYNLQKRTVEDRMLLPGGVGRALVYQHSPSTYIDLAVDEHGLW    211 - 280
AIHSGPGTHSHLVLTKIEPGTLGVEHSWDTPCRSQDAEASFLLCGVLYVVYSTGGQGPHRITCIYDPLGT    281 - 350
ISEEDLPNLFFPKRPRSHSMIHYNPRDKQLYAWNEGNQIIYKLQTKRKLPLK                      351 - 402
//

Text Mined References (9)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
18708057 2008 hOLFML1, a novel secreted glycoprotein, enhances the proliferation of human cancer cell lines in vitro.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.