Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.66
PubTator Score 104.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma 1.170 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.200 5.8e-03
osteosarcoma 2.650 1.2e-07
Pick disease 1.500 7.0e-06
pituitary cancer -1.600 3.2e-05
psoriasis -1.400 1.0e-09

Protein-protein Interaction (9)

Gene RIF (2)

AA Sequence

MLLLWVSVVAALALAVLAPGAGEQRRRAAKAPNVVLVVSDSFDGRLTFHPGSQVVKLPFINFMKTRGTSF      1 - 70
LNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSISN     71 - 140
RVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMERDWQNTDKAVNWLRKEAINYTEPFVIYLGLNLPHPY    141 - 210
PSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYY    211 - 280
AMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQ    281 - 350
VSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLR    351 - 420
TNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVKFPEITYSLDQKLHSIINYPKVSASVHQYNKEQFIK    421 - 490
WKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQWLKTHMNPRAV                            491 - 536
//

Text Mined References (9)

PMID Year Title