Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.66
PubTator Score 104.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.650 0.000
adrenocortical carcinoma 1.170 0.002
intraductal papillary-mucinous neoplasm ... -1.200 0.006
psoriasis -1.400 0.000
Pick disease 1.500 0.000
pituitary cancer -1.600 0.000

Synonym

Accession Q6UWY0 A2BDE3 B4E1I4 Q3ZCW3 Q8N3Q8 ASK
Symbols TSULF

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
23986440 Arylsulfatase K, a novel lysosomal sulfatase.
16500042 The identification, molecular cloning and initial characterization of three new members of this human gene family is reported.

AA Sequence

MLLLWVSVVAALALAVLAPGAGEQRRRAAKAPNVVLVVSDSFDGRLTFHPGSQVVKLPFINFMKTRGTSF      1 - 70
LNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSISN     71 - 140
RVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMERDWQNTDKAVNWLRKEAINYTEPFVIYLGLNLPHPY    141 - 210
PSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYY    211 - 280
AMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQ    281 - 350
VSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLR    351 - 420
TNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVKFPEITYSLDQKLHSIINYPKVSASVHQYNKEQFIK    421 - 490
WKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQWLKTHMNPRAV                            491 - 536
//

Text Mined References (9)

PMID Year Title
23986440 2013 Arylsulfatase K, a novel lysosomal sulfatase.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16500042 2006 Molecular cloning and initial characterization of three novel human sulfatases.
16174644 2005 Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.