Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
Funding $111,799.25
PubMed Score 35.82
PubTator Score 13.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma 1.136 0.000
ulcerative colitis -1.600 0.000

Synonym

Accession Q6UWW8 B2Z3W9 F5H242 Q7Z6J1 Q9H6X7
Symbols ES31

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (5)

PMID Text
22700792 This study provides the first evidence of functional compensation whereby increased expression of CES3 restores intracellular cholesteryl ester hydrolytic activity and free cholesterol efflux in CES1-deficient cells.
20529763 Observational study of gene-disease association. (HuGE Navigator)
20422440 Studies indicate that CES3 mRNA isoform expression in several tissues, particularly in colon, trachea and in brain.
19508181 CES3 seems to have a lower catalytic efficiency than the other two CESs for selected substrates.
18794728 pharmacogenomic characterization of human carboxylesterase 1A1, 1A2, and 1A3 genes

AA Sequence

MERAVRVESGVLVGVVCLLLACPATATGPEVAQPEVDTTLGRVRGRQVGVKGTDRLVNVFLGIPFAQPPL      1 - 70
GPDRFSAPHPAQPWEGVRDASTAPPMCLQDVESMNSSRFVLNGKQQIFSVSEDCLVLNVYSPAEVPAGSG     71 - 140
RPVMVWVHGGALITGAATSYDGSALAAYGDVVVVTVQYRLGVLGFFSTGDEHAPGNQGFLDVVAALRWVQ    141 - 210
ENIAPFGGDLNCVTVFGGSAGGSIISGLVLSPVAAGLFHRAITQSGVITTPGIIDSHPWPLAQKIANTLA    211 - 280
CSSSSPAEMVQCLQQKEGEELVLSKKLKNTIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSW    281 - 350
LIPRGWGLLDTMEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINV    351 - 420
PTVSFSRYLRDSGSPVFFYEFQHRPSSFAKIKPAWVKADHGAEGAFVFGGPFLMDESSRLAFPEATEEEK    421 - 490
QLSLTMMAQWTHFARTGDPNSKALPPWPQFNQAEQYLEINPVPRAGQKFREAWMQFWSETLPSKIQQWHQ    491 - 560
KQKNRKAQEDL                                                               561 - 571
//

Text Mined References (19)

PMID Year Title
22700792 2012 Identification of a novel intracellular cholesteryl ester hydrolase (carboxylesterase 3) in human macrophages: compensatory increase in its expression after carboxylesterase 1 silencing.
20931200 2010 Recommended nomenclature for five mammalian carboxylesterase gene families: human, mouse, and rat genes and proteins.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20422440 2010 Mammalian carboxylesterase 3: comparative genomics and proteomics.
19508181 2009 Human carboxylesterases: an update on CES1, CES2 and CES3.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18794728 2008 Structure and characterization of human carboxylesterase 1A1, 1A2, and 1A3 genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15687373 2005 Hydrolysis of capecitabine to 5'-deoxy-5-fluorocytidine by human carboxylesterases and inhibition by loperamide.
More...