Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
Funding $84,947.5
PubMed Score 28.74
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.000

Synonym

Accession Q6UWV6 Q6ZTS5 Q8IUS8 E-NPP 7
Symbols NPP7
NPP-7
E-NPP 7
ALK-SMase

Gene

 Grant Application (2)

Gene RIF (8)

PMID Text
25100243 NPP7 activity and the ratio of 1.4/1.2 kb products in bile are significantly decreased in malignancy, particularly in cholangiocarcinoma.
22177013 The F275A mutation of NPP7 showed impaired catalytic function whereas L107F mutation showed enhanced catalytic activity.
20839774 predict the three-dimensional structure of NPP7 by homology modeling using a recently crystallized NPP from bacteria. Using the model, we studied the substrate specificity of the enzyme by docking.
16255717 Alkaline sphingomyelinase hydrolyses and inactivates PAF by a phospholipase C activity, a novel function by which it may counteract the development of intestinal inflammation and colon cancer.
15708357 Results describe the cloning of rat alkaline sphingomyelinase from rat intestine, comparison to the human sequence, adjustment of the putative protein in GenBank, and confirmation of the specific expression of the gene in the small intestine.
15458386 alk-SMase activity is severely affected by defective N-glycosylation at 5 sites and by structural alterations of the putative metal-binding sites and the predicted active core.
15016655 intestinal alkaline sphingomyelinase may have a one-exon deletion in colon cancer cells
12885774 identified the amino acid and cDNA sequences of human intestinal alk-SMase, and found that it is a novel ecto-enzyme related to the ecto-nucleotide phosphodiesterase family with specific features essential for its SMase activity

AA Sequence

MRGLAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARDGVKARYMTPA      1 - 70
FVTMTSPCHFTLVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWDNGSVPIWITAQRQGLRAGSF     71 - 140
FYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESP    141 - 210
ERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDY    211 - 280
GPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNN    281 - 350
GEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALP    351 - 420
PDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSEVA                                    421 - 458
//

Text Mined References (16)

PMID Year Title
25100243 2014 Changes of activity and isoforms of alkaline sphingomyelinase (nucleotide pyrophosphatase phosphodiesterase 7) in bile from patients undergoing endoscopic retrograde cholangiopancreatography.
22177013 2011 Computational identification and experimental characterization of substrate binding determinants of nucleotide pyrophosphatase/phosphodiesterase 7.
20839774 2010 Understanding the molecular activity of alkaline sphingomyelinase (NPP7) by computer modeling.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16255717 2006 Intestinal alkaline sphingomyelinase hydrolyses and inactivates platelet-activating factor by a phospholipase C activity.
15708357 2005 Cloning of alkaline sphingomyelinase from rat intestinal mucosa and adjusting of the hypothetical protein XP_221184 in GenBank.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15458386 2005 Functional studies of human intestinal alkaline sphingomyelinase by deglycosylation and mutagenesis.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...