Property Summary

NCBI Gene PubMed Count 16
PubMed Score 29.28
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
colon cancer 1478 3.533 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.400 2.8e-04

Protein-protein Interaction (9)

Gene RIF (9)

AA Sequence

MRGLAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARDGVKARYMTPA      1 - 70
FVTMTSPCHFTLVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWDNGSVPIWITAQRQGLRAGSF     71 - 140
FYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESP    141 - 210
ERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDY    211 - 280
GPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNN    281 - 350
GEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALP    351 - 420
PDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSEVA                                    421 - 458
//

Text Mined References (17)

PMID Year Title