Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.05
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.400 3.7e-14
intraductal papillary-mucinous adenoma (... 1.700 1.5e-04
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.900 1.4e-03
nasopharyngeal carcinoma -1.100 2.7e-05
osteosarcoma -4.418 8.8e-08
psoriasis 1.100 2.3e-74
spina bifida -2.602 4.1e-02
tuberculosis -1.500 1.4e-06

Gene RIF (1)

AA Sequence

MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTY      1 - 70
RPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNI     71 - 140
PMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQE    141 - 210
EEEACMARLCVRCAECLDSDYEETY                                                 211 - 235
//

Text Mined References (10)

PMID Year Title