Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.13
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.1e-07
glioblastoma 1.200 3.7e-06
intraductal papillary-mucinous neoplasm ... -1.600 8.9e-03
lung adenocarcinoma -1.100 2.5e-09
medulloblastoma, large-cell -1.600 1.9e-06
osteosarcoma -1.069 5.1e-05
ovarian cancer -1.600 1.0e-07
posterior fossa group A ependymoma 1.100 2.6e-08

Gene RIF (4)

AA Sequence

MDLAANEISIYDKLSETVDLVRQTGHQCGMSEKAIEKFIRQLLEKNEPQRPPPQYPLLIVVYKVLATLGL      1 - 70
ILLTAYFVIQPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENKGVPLHGGDEDRPFPDFDPWW     71 - 140
TNDCEQNESEPIPANCTGCAQKHLKVMLLEDAPRKFERLHPLVIKTGKPLLEEEIQHFLCQYPEATEGFS    141 - 210
EGFFAKWWRCFPERWFPFPYPWRRPLNRSQMLRELFPVFTHLPFPKDASLNKCSFLHPEPVVGSKMHKMP    211 - 280
DLFIIGSGEAMLQLIPPFQCRRHCQSVAMPIEPGDIGYVDTTHWKVYVIARGVQPLVICDGTAFSEL       281 - 347
//

Text Mined References (16)

PMID Year Title