Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.61
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Gene

Gene RIF (3)

PMID Text
23460338 C60rf89 is a gene that encodes three distinct proteins with the capacity to enhance the activity of histone deacetylases (HDACs) in the nucleolus, the Golgi and the midbody
23460338 C6orf89 encodes one soluble and two type II membrane proteins that function as histone deacetylase enhancers. The 34sp is selectively targeted to the nucleolus and is retained in nucleolar organizer regions in mitotic cells. The 34sp is integrated into the ribosomal gene transcription machinery and is relocalized to the nucleolus upon the arrest of rDNA transcription, protein synthesis, and PI3K/mTORC signalling.
22930588 Overexpression of BRAP may play a role during the antigen presenting process of bronchial epithelium by inhibiting the antigen uptake ability of bronchial epithelial cells.

AA Sequence

MDLAANEISIYDKLSETVDLVRQTGHQCGMSEKAIEKFIRQLLEKNEPQRPPPQYPLLIVVYKVLATLGL      1 - 70
ILLTAYFVIQPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENKGVPLHGGDEDRPFPDFDPWW     71 - 140
TNDCEQNESEPIPANCTGCAQKHLKVMLLEDAPRKFERLHPLVIKTGKPLLEEEIQHFLCQYPEATEGFS    141 - 210
EGFFAKWWRCFPERWFPFPYPWRRPLNRSQMLRELFPVFTHLPFPKDASLNKCSFLHPEPVVGSKMHKMP    211 - 280
DLFIIGSGEAMLQLIPPFQCRRHCQSVAMPIEPGDIGYVDTTHWKVYVIARGVQPLVICDGTAFSEL       281 - 347
//

Text Mined References (16)

PMID Year Title
26460487 2016 Bombesin Receptor-Activated Protein (BRAP) Modulates NF-?B Activation in Bronchial Epithelial Cells by Enhancing HDAC Activity.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23460338 2013 C6orf89 encodes three distinct HDAC enhancers that function in the nucleolus, the golgi and the midbody.
22930588 2013 Role of bombesin receptor activated protein in the antigen presentation by human bronchial epithelial cells.
21857995 2011 Cloning of a novel protein interacting with BRS-3 and its effects in wound repair of bronchial epithelial cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17461456 2007 Screening and cloning for proteins transactivated by the PS1TP5 protein of hepatitis B virus: a suppression subtractive hybridization study.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...