Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -2.800 3.8e-08
Breast cancer 2.800 3.4e-02
cystic fibrosis -2.109 6.5e-06
ductal carcinoma in situ 1.700 2.7e-02
invasive ductal carcinoma 1.200 3.5e-02
non-small cell lung cancer 1.089 5.3e-11
pancreatic cancer 1.100 6.4e-03
psoriasis -2.500 9.6e-45

AA Sequence

MAVSVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSR      1 - 70
STGFMEFDDNEGKHSSK                                                          71 - 87
//

Text Mined References (6)

PMID Year Title