Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cystic fibrosis -2.109 0.000
Atopic dermatitis -2.800 0.000
non-small cell lung cancer 1.089 0.000
pancreatic cancer 1.100 0.006
psoriasis -3.300 0.000
Breast cancer 2.800 0.034
ductal carcinoma in situ 1.700 0.027
invasive ductal carcinoma 1.200 0.035

AA Sequence

MAVSVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSR      1 - 70
STGFMEFDDNEGKHSSK                                                          71 - 87
//

Text Mined References (6)

PMID Year Title
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.