Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UWS5
Symbols CSRP2BP

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (3)

AA Sequence

MSRSSKVVLGLSVLLTAATVAGVHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAERE      1 - 70
KMLLAKGSQKS                                                                71 - 81
//

Text Mined References (6)

PMID Year Title