Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.47

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
22356826 Ortholog of fungal COX assembly protein PET117

AA Sequence

MSRSSKVVLGLSVLLTAATVAGVHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAERE      1 - 70
KMLLAKGSQKS                                                                71 - 81
//

Text Mined References (4)

PMID Year Title
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.