Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.93
PubTator Score 8.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 6.3e-05
ependymoma -2.000 4.8e-02
group 3 medulloblastoma -2.000 8.7e-03
interstitial cystitis -1.100 6.8e-03
pituitary cancer -1.300 2.3e-03
subependymal giant cell astrocytoma -2.061 3.7e-03

Gene RIF (1)

AA Sequence

MAVKLGTLLLALALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSL      1 - 70
SYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGSEPLWVTLTKAKRKVYMYYWP     71 - 140
GCEVEILGVRPTYCLEYKNVPTDINFANAVSDALDSFKSGRADLAAIYHERIDVEGHHYGPASPQRKDAL    141 - 210
KAVDTVLKYMTKWIQERGLQDRLNVIIFSDHGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAP    211 - 280
GKHSEIYNKLSTVEHMTVYEKEAIPSRFYYKKGKFVSPLTLVADEGWFITENREMLPFWMNSTGRREGWQ    281 - 350
RGWHGYDNELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSRVMCMLKGRAST    351 - 420
APPVWPSHCALALILLFLLA                                                      421 - 440
//

Text Mined References (9)

PMID Year Title