Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.34
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -2.000 0.048
group 3 medulloblastoma -2.000 0.009
atypical teratoid/rhabdoid tumor -1.900 0.000
interstitial cystitis -1.100 0.007
subependymal giant cell astrocytoma -2.061 0.004
pituitary cancer -1.300 0.002

Synonym

Accession Q6UWR7 Q4W5Q1 Q96M57 E-NPP 6
Symbols NPP6

Gene

Gene RIF (1)

PMID Text
15788404 NPP6 has a specific role through the hydrolysis of polyunsaturated LPC, glycerophosphorylcholine, or sphingosylphosphorylcholine in kidney and brain

AA Sequence

MAVKLGTLLLALALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSL      1 - 70
SYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGSEPLWVTLTKAKRKVYMYYWP     71 - 140
GCEVEILGVRPTYCLEYKNVPTDINFANAVSDALDSFKSGRADLAAIYHERIDVEGHHYGPASPQRKDAL    141 - 210
KAVDTVLKYMTKWIQERGLQDRLNVIIFSDHGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAP    211 - 280
GKHSEIYNKLSTVEHMTVYEKEAIPSRFYYKKGKFVSPLTLVADEGWFITENREMLPFWMNSTGRREGWQ    281 - 350
RGWHGYDNELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSRVMCMLKGRAST    351 - 420
APPVWPSHCALALILLFLLA                                                      421 - 440
//

Text Mined References (9)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23161088 2013 Bovine brain myelin glycerophosphocholine choline phosphodiesterase is an alkaline lysosphingomyelinase of the eNPP-family, regulated by lysosomal sorting.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15788404 2005 Biochemical and molecular characterization of a novel choline-specific glycerophosphodiester phosphodiesterase belonging to the nucleotide pyrophosphatase/phosphodiesterase family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.