Property Summary

NCBI Gene PubMed Count 4
Grant Count 2
Funding $104,268
PubMed Score 0.08
PubTator Score 0.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.001
Atopic dermatitis -2.200 0.000
non-small cell lung cancer 1.242 0.000
pancreatic cancer 1.400 0.000
psoriasis -2.400 0.000
lung adenocarcinoma 1.400 0.000

AA Sequence

MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPC      1 - 70
TFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP                          71 - 119
//

Text Mined References (6)

PMID Year Title
21454693 2011 Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1.
16890402 2006 IGFL: A secreted family with conserved cysteine residues and similarities to the IGF superfamily.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.