Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.33
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSI      1 - 70
DYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSE     71 - 140
WKKGCEVS                                                                  141 - 148
//

Text Mined References (9)

PMID Year Title