Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.25
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
26920053 The recombinant protein (DHRS11) efficiently catalyzed the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5alpha-androstanes into their 17beta-hydroxyl metabolites with NADPH as a coenzyme.

AA Sequence

MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD      1 - 70
LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN     71 - 140
VDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVVETQFAFKLH    141 - 210
DKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTEQVT                        211 - 260
//

Text Mined References (7)

PMID Year Title
26920053 2016 Human dehydrogenase/reductase (SDR family) member 11 is a novel type of 17?-hydroxysteroid dehydrogenase.
21269460 2011 Initial characterization of the human central proteome.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.