Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.25
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 3.79372232514693E-8
malignant mesothelioma 3163 3.45934062631714E-6
pituitary cancer 1972 5.82589478578001E-6
interstitial cystitis 2299 1.43688776712962E-4
colon cancer 1475 1.44342686220569E-4
sonic hedgehog group medulloblastoma 1482 0.0022744547479857
active Crohn's disease 918 0.0095886549080426
astrocytic glioma 2241 0.0155176263730422
spina bifida 1064 0.0366642971409801
lung cancer 4473 0.0367376509889872

Synonym

Accession Q6UWP2 B2RDZ3 Q9BUC7 Q9H674
Symbols ARPG836
SDR24C1
spDHRS11

Gene

PANTHER Protein Class (2)

PDB

1XG5  

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
26920053 The recombinant protein (DHRS11) efficiently catalyzed the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5alpha-androstanes into their 17beta-hydroxyl metabolites with NADPH as a coenzyme.

AA Sequence

MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD      1 - 70
LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN     71 - 140
VDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVVETQFAFKLH    141 - 210
DKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTEQVT                        211 - 260
//

Text Mined References (7)

PMID Year Title
26920053 2016 Human dehydrogenase/reductase (SDR family) member 11 is a novel type of 17?-hydroxysteroid dehydrogenase.
21269460 2011 Initial characterization of the human central proteome.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.