Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.91
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.866 9.6e-03
active ulcerative colitis -1.470 4.6e-03
astrocytic glioma -1.400 1.6e-02
colon cancer -2.100 1.4e-04
interstitial cystitis -1.300 2.0e-03
lung cancer 1.300 3.7e-02
malignant mesothelioma 1.400 3.5e-06
pituitary cancer 1.400 5.8e-06
sonic hedgehog group medulloblastoma -1.100 2.3e-03
spina bifida -1.926 3.7e-02

Gene RIF (1)

AA Sequence

MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD      1 - 70
LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN     71 - 140
VDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVVETQFAFKLH    141 - 210
DKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTEQVT                        211 - 260
//

Text Mined References (7)

PMID Year Title