Property Summary

NCBI Gene PubMed Count 4
Grant Count 7
R01 Count 4
Funding $1,922,860.5
PubMed Score 167.99
PubTator Score 570.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (1)

PMID Text
18187620 Knockdown of LY6/PLAUR domain containing 4 (LYPD4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLMRNMVCKLQEGCEETLVFIET      1 - 70
GTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASC     71 - 140
SCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKV    141 - 210
TEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD                                      211 - 246
//

Text Mined References (4)

PMID Year Title
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.