Property Summary

NCBI Gene PubMed Count 4
PubMed Score 167.99
PubTator Score 570.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.00127620468907993
Disease Target Count Z-score Confidence
Mitral valve insufficiency 17 4.05 2.0
Listeriosis 17 3.216 1.6

Synonym

Accession Q6UWN0 Q8IYW0
Symbols SMR

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (1)

PMID Text
18187620 Knockdown of LY6/PLAUR domain containing 4 (LYPD4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLMRNMVCKLQEGCEETLVFIET      1 - 70
GTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASC     71 - 140
SCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKV    141 - 210
TEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD                                      211 - 246
//

Text Mined References (4)

PMID Year Title
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.