Property Summary

NCBI Gene PubMed Count 4
PubMed Score 178.95
PubTator Score 570.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

AA Sequence

MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLMRNMVCKLQEGCEETLVFIET      1 - 70
GTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASC     71 - 140
SCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKV    141 - 210
TEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD                                      211 - 246
//

Text Mined References (4)

PMID Year Title