Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.04
PubTator Score 1.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKA      1 - 70
WANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQ     71 - 140
LVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCRTPQLII    141 - 210
PNQNPFLKPTGRAPQQTAFNPFSLGFLLLRIF                                          211 - 242
//

Text Mined References (5)

PMID Year Title