Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.05
PubTator Score 1.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
23333304 HIV-1 Vif downregulates the expression of GLI pathogenesis-related 1 like 1 (GLIPR1L1) in Vif-expression T cells

AA Sequence

MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKA      1 - 70
WANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQ     71 - 140
LVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCRTPQLII    141 - 210
PNQNPFLKPTGRAPQQTAFNPFSLGFLLLRIF                                          211 - 242
//

Text Mined References (5)

PMID Year Title
16714093 2006 Identification and characterization of RTVP1/GLIPR1-like genes, a novel p53 target gene cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.