Property Summary

NCBI Gene PubMed Count 19
Grant Count 12
R01 Count 6
Funding $863,304.81
PubMed Score 28.29
PubTator Score 14.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
24219158 summarize the current knowledge of the functions of nephrin and Neph-family proteins and transcription factors and agents that control nephrin and Neph3 gene expression.
21980157 Transcription of nephrin-Neph3 gene pair is synergistically activated by WT1 and NF-kappaB and silenced by DNA methylation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19703278 NF-kappaB and Sp1 response elements are essential for the basal transcriptional activity of the Neph3 promoter.
16741999 Filtrin can act as autoantigen, and autoantibodies against these can be detected in patients with type 1 diabetes.
12837264 KIRREL2 protein is a beta-cell-expressed Ig domain protein and may be involved in pancreas development or beta cell function
12504092 Identification of Filtrin as a member of nephrin-like proteins.
12504092 Filtrin is a novel protein with substantial homology to nephrin. It is a transmembrane protein of the immunoglobulin superfamily (apparent molecular weight 107 kDa) and most prominently expressed in the pancreas, lymph nodes as well as kidney glomerulus.

AA Sequence

MLRMRVPALLVLLFCFRGRAGPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLP      1 - 70
GWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGV     71 - 140
PANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQA    141 - 210
LPTGRDTAITLSLQYPPEVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVA    211 - 280
DASFLTEPVSCEVSNAVGSANRSTALDVLFGPILQAKPEPVSVDVGEDASFSCAWRGNPLPRVTWTRRGG    281 - 350
AQVLGSGATLRLPSVGPEDAGDYVCRAEAGLSGLRGGAAEARLTVNAPPVVTALHSAPAFLRGPARLQCL    351 - 420
VFASPAPDAVVWSWDEGFLEAGSQGRFLVETFPAPESRGGLGPGLISVLHISGTQESDFSRSFNCSARNR    421 - 490
LGEGGAQASLGRRDLLPTVRIVAGVAAATTTLLMVITGVALCCWRHSKASASFSEQKNLMRIPGSSDGSS    491 - 560
SRGPEEEETGSREDRGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSP    561 - 630
LGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPS    631 - 700
HPRLQTHV                                                                  701 - 708
//

Text Mined References (21)

PMID Year Title
26324709 2015 Kin of IRRE-like Protein 2 Is a Phosphorylated Glycoprotein That Regulates Basal Insulin Secretion.
25416956 2014 A proteome-scale map of the human interactome network.
24219158 2014 Functions of the podocyte proteins nephrin and Neph3 and the transcriptional regulation of their genes.
21980157 2012 Transcription of nephrin-Neph3 gene pair is synergistically activated by WT1 and NF-?B and silenced by DNA methylation.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19703278 2009 Regulation of Neph3 gene in podocytes--key roles of transcription factors NF-kappaB and Sp1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...