Property Summary

NCBI Gene PubMed Count 6
PubMed Score 64.96
PubTator Score 32.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis -3.093 4.4e-02
adult high grade glioma 2.000 6.8e-04
Atopic dermatitis 1.900 1.2e-02
atypical teratoid / rhabdoid tumor 1.700 6.6e-04
cystic fibrosis 1.900 1.8e-02
Endometriosis -1.011 4.5e-02
glioblastoma 1.700 1.7e-04
interstitial cystitis -3.500 5.3e-04
medulloblastoma 1.200 1.5e-02
medulloblastoma, large-cell 2.100 4.3e-05
non-small cell lung cancer 1.509 6.4e-08
ovarian cancer 2.300 1.5e-11
psoriasis 5.000 2.8e-77

Gene RIF (1)

AA Sequence

MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPR      1 - 70
LWVVPGALPQV                                                                71 - 81
//

Text Mined References (7)

PMID Year Title