Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.86
PubTator Score 1.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.22889995923264E-8
ovarian cancer 8492 6.13628454338839E-6
pediatric high grade glioma 2712 6.17538292915684E-4
acute quadriplegic myopathy 1157 0.00112319417067586
sonic hedgehog group medulloblastoma 1482 0.00235140783692141
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0032102618912957
non primary Sjogren syndrome sicca 840 0.0188612984512572
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0452731850536528

Expression

Synonym

Accession Q6UWJ1 Q5JSB1 Q6NUN1 Q8NG29 Q8TCI6 Q96EA6 Q9NWT2
Symbols C13orf11

Gene

PANTHER Protein Class (1)

  Ortholog (13)

 CSPA Cell Line (2)

Pathway (1)

AA Sequence

MKVLGRSFFWVLFPVLPWAVQAVEHEEVAQRVIKLHRGRGVAAMQSRQWVRDSCRKLSGLLRQKNAVLNK      1 - 70
LKTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRALQGDYKDVVNMKESSRQRLE     71 - 140
ALREAAIKEETEYMELLAAEKHQVEALKNMQHQNQSLSMLDEILEDVRKAADRLEEEIEEHAFDDNKSVK    141 - 210
GVNFEAVLRVEEEEANSKQNITKREVEDDLGLSMLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGML    211 - 280
SLPCGWLCTAIGLPTMFGYIICGVLLGPSGLNSIKSIVQVETLGEFGVFFTLFLVGLEFSPEKLRKVWKI    281 - 350
SLQGPCYMTLLMIAFGLLWGHLLRIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGM    351 - 420
LVTQDVQLGLFMAVMPTLIQAGASASSSIVVEVLRILVLIGQILFSLAAVFLLCLVIKKYLIGPYYRKLH    421 - 490
MESKGNKEILILGISAFIFLMLTVTELLDVSMELGCFLAGALVSSQGPVVTEEIATSIEPIRDFLAIVFF    491 - 560
ASIGLHVFPTFVAYELTVLVFLTLSVVVMKFLLAALVLSLILPRSSQYIKWIVSAGLAQVSEFSFVLGSR    561 - 630
ARRAGVISREVYLLILSVTTLSLLLAPVLWRAAITRCVPRPERRSSL                           631 - 677
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.