Property Summary

NCBI Gene PubMed Count 4
Grant Count 5
R01 Count 5
Funding $306,302
PubMed Score 3.53
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UWI4 B9EH70 Q5W0G8
Symbols TMEM46
hShisa
C13orf13
PRO28631
WGAR9166
bA398O19.2

Gene

Gene RIF (1)

PMID Text
18976975 Knockdown of shisa homolog 2 (SHISA2; TMEM46) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MWGARRSSVSSSWNAASLLQLLLAALLAAGARASGEYCHGWLDAQGVWRIGFQCPERFDGGDATICCGSC      1 - 70
ALRYCCSSAEARLDQGGCDNDRQQGAGEPGRADKDGPDGSAVPIYVPFLIVGSVFVAFIILGSLVAACCC     71 - 140
RCLRPKQDPQQSRAPGGNRLMETIPMIPSASTSRGSSSRQSSTAASSSSSANSGARAPPTRSQTNCCLPE    141 - 210
GTMNNVYVNMPTNFSVLNCQQATQIVPHQGQYLHPPYVGYTVQHDSVPMTAVPPFMDGLQPGYRQIQSPF    211 - 280
PHTNSEQKMYPAVTV                                                           281 - 295
//

Text Mined References (6)

PMID Year Title
17481602 2007 Mouse homologues of Shisa antagonistic to Wnt and Fgf signalings.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.