Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.51
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.120 2.6e-03
Breast cancer 3.800 2.3e-02
cystic fibrosis -2.100 2.1e-03
head and neck cancer and chronic obstruc... -1.800 1.6e-03
intraductal papillary-mucinous neoplasm ... 3.200 1.7e-02
invasive ductal carcinoma 3.200 2.2e-02
oligodendroglioma -1.800 3.1e-02
osteosarcoma 2.070 4.5e-02
ovarian cancer 3.100 8.7e-04
pancreatic cancer 2.100 8.7e-06
pituitary cancer -1.500 1.3e-04
primary pancreatic ductal adenocarcinoma 1.149 4.8e-02
tuberculosis -1.100 2.4e-03

Gene RIF (1)

AA Sequence

MWGARRSSVSSSWNAASLLQLLLAALLAAGARASGEYCHGWLDAQGVWRIGFQCPERFDGGDATICCGSC      1 - 70
ALRYCCSSAEARLDQGGCDNDRQQGAGEPGRADKDGPDGSAVPIYVPFLIVGSVFVAFIILGSLVAACCC     71 - 140
RCLRPKQDPQQSRAPGGNRLMETIPMIPSASTSRGSSSRQSSTAASSSSSANSGARAPPTRSQTNCCLPE    141 - 210
GTMNNVYVNMPTNFSVLNCQQATQIVPHQGQYLHPPYVGYTVQHDSVPMTAVPPFMDGLQPGYRQIQSPF    211 - 280
PHTNSEQKMYPAVTV                                                           281 - 295
//

Text Mined References (6)

PMID Year Title