Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MQIQNNLFFCCYTVMSAIFKWLLLYSLPALCFLLGTQESESFHSKAEILVTLSQVIISPAGPHALTWTTH      1 - 70
FSPSVIIILVPCWWHAVIVTQHPVANCYVTNHLNIQWLELKAGS                               71 - 114
//

Text Mined References (1)

PMID Year Title