1. Home
  2. Targets
  3. SLP adapter and CSK-interacting membrane protein

Tdark SLP adapter and CSK-interacting membrane protein

Lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex (MHC) class II signaling transduction. Required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation.

This gene encodes a transmembrane adaptor protein that is expressed in antigen-presenting cells and is localized in the immunologic synapse. The encoded protein is involved in major histocompatibility complex class II signal transduction and immune synapse formation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.90
PubTator Score 0.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Disease Z-score Confidence
Alzheimer's disease 644
lung adenocarcinoma 2,713
lung carcinoma 2,844
mucosa-associated lymphoid tissue lympho... 480 

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000
lung carcinoma -2.900 0.000
mucosa-associated lymphoid tissue lympho... 2.776 0.035

Synonym

Accession Q6UWF3 A6XGL4 B4DLK1 Q96MD0
Symbols UNQ5783
C17orf87

Gene

SCIMP

 GO Component (6)

 GO Process (1)

 Compartment GO Term (22)

See all...

 MGI Term (3)

 GWAS Trait (1)

Pathway (1)

 UniProt Keyword (9)

Gene RIF (1)

PMID Text
21930792 results suggest that SCIMP is involved in signal transduction after MHC-II stimulation and therefore serves as a regulator of antigen presentation and other APC functions.

AA Sequence 

MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYE      1 - 70
NVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANT     71 - 140
EKASF                                                                     141 - 145
//

Text Mined References (8)

PMID Year Title
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.