Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.44
PubTator Score 0.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.100 3.1e-05
lung carcinoma -2.900 4.9e-24
mucosa-associated lymphoid tissue lympho... 2.776 3.5e-02

Gene RIF (1)

AA Sequence

MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYE      1 - 70
NVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANT     71 - 140
EKASF                                                                     141 - 145
//

Text Mined References (8)

PMID Year Title