Property Summary

NCBI Gene PubMed Count 27
Grant Count 8
Funding $352,522.92
PubMed Score 738.70
PubTator Score 143.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25484098 Plant homeodomain finger protein 23 negatively regulates cell autophagy by promoting ubiquitination and degradation of E3 ligase LRSAM1
24894446 disruption of the C-terminal RING domain confers dominant negative properties to LRSAM1
23245322 Authors identify LRSAM1 as the E3 ligase responsible for anti-Salmonella autophagy-associated ubiquitination.
22781092 Our data further confirms that LRSAM1 mutations are associated with CMT2 of AD inheritance.
22012984 homozygous mutation in LRSAM1 was proposed as a strong candidate for the disease in a family with recessive axonal polyneuropathy
20865121 LRSAM1 is a strong candidate for the causal gene for the Charcot-Marie-Tooth disease.
20616063 LRSAM1 as a component of the antibacterial autophagic response.
18077552 Tal polyubiquitinates lysine residues in the C-terminus of uncomplexed Tsg101, resulting in proteasomal degradation.
16808324 TAL, a Tsg101-associated ligase, binds and ubiquitinates Tsg101; TAL-mediated binding and ubiquitination of Tsg101 cooperatively regulate release of HIV-1 Gag
15256501 Tal regulates a Tsg101-associated complex responsible for the sorting of cargo into cytoplasm-containing vesicles that bud at the multivesicular body and at the plasma membrane
More...

AA Sequence

MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVLIVHTNHLTSL      1 - 70
LPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLPRSIGNLTQLQTLNVKDNKLK     71 - 140
ELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSLDASAMVYPPREVCGAGTAAILQFLCKESGL    141 - 210
EYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQRE    211 - 280
HTQLLQQSSSQKDEILQTVKEEQSRLEQGLSEHQRHLNAERQRLQEQLKQTEQNISSRIQKLLQDNQRQK    281 - 350
KSSEILKSLENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS    351 - 420
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIETELLQLTQLEL    421 - 490
KRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKSETRQENYWLIQYQRLLNQKP    491 - 560
LSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILRRVQELL    561 - 630
DAARIQPELKPPMGEVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCC    631 - 700
QPLRTCPLCRQDIAQRLRIYHSS                                                   701 - 723
//

Text Mined References (30)

PMID Year Title
25484098 2014 PHF23 (plant homeodomain finger protein 23) negatively regulates cell autophagy by promoting ubiquitination and degradation of E3 ligase LRSAM1.
25416956 2014 A proteome-scale map of the human interactome network.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
24894446 2014 A novel mutation in LRSAM1 causes axonal Charcot-Marie-Tooth disease with dominant inheritance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23245322 2012 The LRR and RING domain protein LRSAM1 is an E3 ligase crucial for ubiquitin-dependent autophagy of intracellular Salmonella Typhimurium.
22781092 2013 A novel LRSAM1 mutation is associated with autosomal dominant axonal Charcot-Marie-Tooth disease.
22012984 2012 A frameshift mutation in LRSAM1 is responsible for a dominant hereditary polyneuropathy.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
More...