Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.800 2.0e-03
Astrocytoma, Pilocytic 1.600 1.2e-05
glioblastoma 1.300 2.9e-03
head and neck cancer -1.200 1.5e-02
interstitial cystitis 1.200 2.1e-02
nasopharyngeal carcinoma -1.500 3.3e-02
non primary Sjogren syndrome sicca -1.200 2.5e-02
non-small cell lung cancer -2.125 3.5e-20
osteosarcoma -4.386 2.4e-04
ovarian cancer -2.800 6.9e-07
periodontitis 1.600 4.8e-23
ulcerative colitis 2.600 8.2e-05

Gene RIF (1)

AA Sequence

MPLTPEPPSGRVEGPPAWEAAPWPSLPCGPCIPIMLVLATLAALFILTTAVLAERLFRRALRPDPSHRAP      1 - 70
TLVWRPGGELWIEPMGTARERSEDWYGSAVPLLTDRAPEPPTQVGTLEARATAPPAPSAPNSAPSNLGPQ     71 - 140
TVLEVPARSTFWGPQPWEGRPPATGLVSWAEPEQRPEASVQFGSPQARRQRPGSPDPEWGLQPRVTLEQI    141 - 210
SAFWKREGRTSVGF                                                            211 - 224
//

Text Mined References (8)

PMID Year Title