Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
periodontitis 269 4.78552814489361E-23
non-small cell lung cancer 2798 3.49272041625322E-20
ovarian cancer 8492 6.88211559839601E-7
pilocytic astrocytoma 3086 7.51311664851433E-6
ulcerative colitis 2087 8.16849161642037E-5
osteosarcoma 7933 2.44872374568993E-4
primary Sjogren syndrome 789 3.64803380850687E-4
interstitial cystitis 2299 3.99640752769493E-4
adult high grade glioma 2148 0.00197578497911692
glioblastoma 5572 0.00291798690633684
head and neck cancer 270 0.0145984263787579
nasopharyngeal carcinoma 1056 0.0325422527373551

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -4.386 0.000
glioblastoma 1.300 0.003
periodontitis 1.600 0.000
non-small cell lung cancer -2.125 0.000
interstitial cystitis 1.300 0.000
adult high grade glioma 1.800 0.002
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 2.000 0.000
nasopharyngeal carcinoma -1.500 0.033
ulcerative colitis 2.600 0.000
ovarian cancer -2.800 0.000
head and neck cancer -1.200 0.015

Synonym

Accession Q6UWD8 A6NJR6 Q8NAB0
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG

AA Sequence

MPLTPEPPSGRVEGPPAWEAAPWPSLPCGPCIPIMLVLATLAALFILTTAVLAERLFRRALRPDPSHRAP      1 - 70
TLVWRPGGELWIEPMGTARERSEDWYGSAVPLLTDRAPEPPTQVGTLEARATAPPAPSAPNSAPSNLGPQ     71 - 140
TVLEVPARSTFWGPQPWEGRPPATGLVSWAEPEQRPEASVQFGSPQARRQRPGSPDPEWGLQPRVTLEQI    141 - 210
SAFWKREGRTSVGF                                                            211 - 224
//

Text Mined References (8)

PMID Year Title
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.