Property Summary

NCBI Gene PubMed Count 5
Grant Count 3
Funding $1,097,972
PubMed Score 3.86
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Alzheimer's disease 644 1.0

Expression

Gene RIF (1)

PMID Text
18844450 T-SP1 protein was detectable in prostate cancer and in some ovarian cancer tissues, indicating tumor-related synthesis of T-SP1

AA Sequence

MLLFSVLLLLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFEGRTRYSRITG      1 - 70
GMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLTSPSMEIKEVA     71 - 140
SIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWRECWVAGWGQTNAADKNSVKTDLM    141 - 210
KAPMVIMDWEECSKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKN    211 - 280
TPGIYTSLVNYNLWIEKVTQLEGRPFNAEKRRTSVKQKPMGSPVSGVPEPGSPRSWLLLCPLSHVLFRAI    281 - 350
LY                                                                        351 - 352
//

Text Mined References (7)

PMID Year Title
23436708 2013 Scanning of novel cancer/testis proteins by human testis proteomic analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
18844450 2008 T-SP1: a novel serine protease-like protein predominantly expressed in testis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.