Property Summary

NCBI Gene PubMed Count 21
PubMed Score 80.93
PubTator Score 34.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 3.4e-04
Atopic dermatitis 1.200 1.4e-03
Breast cancer 1.600 3.3e-02
colon cancer 1.300 4.7e-03
cutaneous lupus erythematosus 1.300 2.6e-02
interstitial cystitis 1.800 2.1e-03
malignant mesothelioma 2.800 2.1e-08
medulloblastoma -1.300 2.4e-02
medulloblastoma, large-cell -2.400 6.2e-05
nephrosclerosis 1.276 3.9e-04
osteosarcoma -1.807 7.4e-03
ovarian cancer 1.600 1.1e-03
primary Sjogren syndrome 1.100 1.3e-02
ulcerative colitis 1.100 1.3e-03

Gene RIF (16)

AA Sequence

MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQS      1 - 70
QKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFS     71 - 140
EDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRM    141 - 210
EKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPE    211 - 280
GITCCCSLIPSGAEWARVSAVNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLE    281 - 350
HVVDWARDGDPLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGP    351 - 420
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDLPWGPCELWVT    421 - 490
ASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSGRCYHLRHKVLPRWVWEKVPD    491 - 560
PANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESSQPAQATAPLDSGYEKHFLPTPEELGLLGPP    561 - 630
RPQVLA                                                                    631 - 636
//

Text Mined References (21)

PMID Year Title