Property Summary

NCBI Gene PubMed Count 20
Grant Count 14
R01 Count 8
Funding $1,668,710.49
PubMed Score 74.81
PubTator Score 34.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis 1.276 0.000
malignant mesothelioma 3.900 0.000
cutaneous lupus erythematosus 1.300 0.026
osteosarcoma -1.807 0.007
medulloblastoma -1.300 0.024
medulloblastoma, large-cell -2.400 0.000
Atopic dermatitis 1.200 0.001
colon cancer 1.500 0.011
interstitial cystitis 1.800 0.002
pilocytic astrocytoma 1.700 0.000
primary Sjogren syndrome 1.100 0.013
Breast cancer 1.600 0.033
ulcerative colitis 1.100 0.001
ovarian cancer 1.600 0.001

Gene RIF (14)

PMID Text
26649511 Findings demonstrated that IL-27 and IL-27R were elevated in multiple sclerosis lesions and that local IL-27 can modulate immune properties of astrocytes and infiltrating immune cells
26282876 The significant expression of IL-27 in TB and the negative influence of IL-27R on T cell function demonstrate the pathway by which this cytokine/receptor pair is detrimental in TB.
24771852 natural sIL-27Ralpha binds rIL-27, inhibits IL-27 binding to its cell surface receptor, and is a potent inhibitor of IL-27 signaling, as shown by its ability to specifically block IL-27-mediated STAT activation, at low molar excess over IL-27.
22936014 Aberrant hypermethylation and reduced expression of IL27RA is associated with myelodysplastic syndromes.
22312192 TCCR/WSX-1 is closely associated with angiogenesis and could serve as a novel therapeutic target in patients with age-related macular degeneration.
21631431 Mutations in the transmembrane and juxtamembrane domains enhance IL27R transforming activity.
20503287 Observational study of gene-disease association. (HuGE Navigator)
19549909 Results reveal an interleukin 27-independent function of WSX1 sensitizing natural killer cell-mediated antitumor surveillance.
19386761 These results indicate that humanin protects neurons by binding to a complex or complexes involving CNTFR/WSX-1/gp130.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQS      1 - 70
QKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFS     71 - 140
EDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRM    141 - 210
EKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPE    211 - 280
GITCCCSLIPSGAEWARVSAVNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLE    281 - 350
HVVDWARDGDPLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGP    351 - 420
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDLPWGPCELWVT    421 - 490
ASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSGRCYHLRHKVLPRWVWEKVPD    491 - 560
PANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESSQPAQATAPLDSGYEKHFLPTPEELGLLGPP    561 - 630
RPQVLA                                                                    631 - 636
//

Text Mined References (20)

PMID Year Title
26649511 2016 Production of IL-27 in multiple sclerosis lesions by astrocytes and myeloid cells: Modulation of local immune responses.
26282876 2015 Interleukin 27R regulates CD4+ T cell phenotype and impacts protective immunity during Mycobacterium tuberculosis infection.
24771852 2014 A soluble form of IL-27R? is a natural IL-27 antagonist.
22936014 2013 Genome-wide profiling of methylation identifies novel targets with aberrant hypermethylation and reduced expression in low-risk myelodysplastic syndromes.
22312192 2012 TCCR/WSX-1 is a novel angiogenic factor in age-related macular degeneration.
21631431 2011 Mutations in the transmembrane and juxtamembrane domains enhance IL27R transforming activity.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
19549909 2009 Expression of WSX1 in tumors sensitizes IL-27 signaling-independent natural killer cell surveillance.
19386761 2009 Humanin inhibits neuronal cell death by interacting with a cytokine receptor complex or complexes involving CNTF receptor alpha/WSX-1/gp130.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
More...