Property Summary

NCBI Gene PubMed Count 16
PubMed Score 976.17
PubTator Score 9.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 5.000 1.1e-178

Gene RIF (3)

AA Sequence

MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCIN      1 - 70
GACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKL     71 - 140
KSPYNVCSGERRPL                                                            141 - 154
//

Text Mined References (17)

PMID Year Title