1. Home
  2. Targets
  3. signaling molecule
  4. growth factor
  5. Epigen

Tbio Epigen

Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases.

The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 15
Grant Count 17
R01 Count 7
Funding $2,285,182.25
PubMed Score 930.93
PubTator Score 9.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (20)

Disease Z-score Confidence
Schistosomiasis 38 6.516 3.3
Clonorchiasis 15 5.794 2.9
Fascioliasis 18 5.697 2.8
Trichostrongylosis 1 5.386 2.7
Trichuriasis 5 5.177 2.6
Metagonimiasis 2 5.055 2.5
Hard palate cancer 11 4.512 2.3
Opisthorchiasis 14 4.352 2.2
Speech disorder 7 4.256 2.1
Capillariasis 2 4.098 2.0
Cleft palate 125 4.077 2.0
Ancylostomiasis 6 3.814 1.9
Ascariasis 7 3.724 1.9
Dicrocoeliasis 1 3.571 1.8
Anemia 252 3.559 1.8
Necatoriasis 1 3.55 1.8
Paragonimiasis 9 3.437 1.7
Gastroenteritis 46 3.23 1.6
Diarrhea 155 3.199 1.6
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 5.000 0.000

Synonym

Accession Q6UW88 A1BMM3 A1BMM4 A1BMM5 A1BMM6 A1BMM7 A1BMM8 A8K090
Symbols EPG
PRO9904
ALGV3072

Gene

EPGN

PANTHER Protein Class (2)

 Grant Application (17)

See all...

 GO Function (2)

 GO Component (3)

 GO Process (8)

 Compartment GO Term (15)

 IMPC Term (4)

 MGI Term (5)

Pathway (1)

 UniProt Keyword (13)

See all...

Gene RIF (2)

PMID Text
15611079 EPG is an EGF-like growth factor and a low affinity ligand
112783 cloning of a related gene in mouse

AA Sequence 

MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCIN      1 - 70
GACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKL     71 - 140
KSPYNVCSGERRPL                                                            141 - 154
//

Text Mined References (16)

PMID Year Title
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22260327 2012 EGFR ligands exhibit functional differences in models of paracrine and autocrine signaling.
22193422 2012 Autocrine epidermal growth factor receptor ligand production and cetuximab response in head and neck squamous cell carcinoma cell lines.
21514161 2011 Amphiregulin exosomes increase cancer cell invasion.
19760033 2010 The complete family of epidermal growth factor receptors and their ligands are co-ordinately expressed in breast cancer.
17169360 2007 Ectodomain shedding of the EGF-receptor ligand epigen is mediated by ADAM17.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16469638 2006 Gene expression profiling of ERBB receptors and ligands in human transitional cell carcinoma of the bladder.
15611079 2005 Epigen, the last ligand of ErbB receptors, reveals intricate relationships between affinity and mitogenicity.
More...