Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.27
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UW78 Q5FVD5
Symbols MC3DN9
UNQ655
C11orf83
CCDS41658.1

Gene

Gene RIF (3)

PMID Text
25605331 C11orf83 depletion in HeLa cells caused abnormal crista morphology, higher sensitivity to apoptosis, a decreased ATP level due to impaired respiration and subtle, but significant, changes in cardiolipin composition.
25008109 UQCC3 functions in complex III assembly and that the c.59T>A mutation has a causal role in complex III deficiency.
20159687 AY358935 is a predicted secretary protein with a small molecular weight that might have important functions in cellular proliferation and anti-viral innate immune regulation.

AA Sequence

MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATT      1 - 70
QENVAWRKNWMVGGEGGAGGRSP                                                    71 - 93
//

Text Mined References (9)

PMID Year Title
25605331 2015 C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization.
25008109 2014 A mutation in the human CBP4 ortholog UQCC3 impairs complex III assembly, activity and cytochrome b stability.
20159687 2010 [Bioinformatics analysis and function prediction of the novel gene AY358935].
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.