Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.89
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATT      1 - 70
QENVAWRKNWMVGGEGGAGGRSP                                                    71 - 93
//

Text Mined References (10)

PMID Year Title