Property Summary

NCBI Gene PubMed Count 7
Grant Count 13
Funding $1,534,541.99
PubMed Score 1.42
PubTator Score 3.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
urothelial carcinoma -1.100 0.047
pancreatic ductal adenocarcinoma liver m... -1.430 0.005
diabetes mellitus -1.200 0.001
ovarian cancer 1.600 0.000

Gene RIF (2)

PMID Text
24643204 The genetic polymorphisms in OCT2, AQP2, AQP9 and TMEM205 may contribute to chemotherapy response in lung cancer patients.
20589834 Results indicate that a novel mechanism for cisplatin resistance is mediated by TMEM205 overexpression.

AA Sequence

MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHISMGCAFINLC      1 - 70
ILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLGGEVPGSHQGPDPY     71 - 140
RQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL                         141 - 189
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24643204 2014 The association of transporter genes polymorphisms and lung cancer chemotherapy response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20589834 2010 Elevated expression of TMEM205, a hypothetical membrane protein, is associated with cisplatin resistance.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...