Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.67
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.168 2.9e-03
atypical teratoid / rhabdoid tumor 1.700 2.6e-06
glioblastoma 1.200 8.7e-06
group 3 medulloblastoma 1.500 6.2e-04
lung cancer 1.400 9.0e-03
malignant mesothelioma -1.200 8.5e-07
medulloblastoma, large-cell 1.800 4.5e-04
mucosa-associated lymphoid tissue lympho... -1.129 1.8e-02
ovarian cancer -1.500 7.3e-08
primitive neuroectodermal tumor 1.500 5.2e-04

Synonym

Accession Q6UW63 Q53HL3 Q9BVD2
Symbols EP58
ERp58
KDEL1

Gene

PDB

2DI7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MFGTLLLYCFFLATVPALAETGGERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKV      1 - 70
FQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEIKFQGQHVAKSPYILKGPVYHENCDCP     71 - 140
LQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIPKRFGQRQSLCHYTLKDNKVYIKTHGEHVGF    141 - 210
RIFMDAILLSLTRKVKMPDVELFVNLGDWPLEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETM    211 - 280
GRVSLDMMSVQANTGPPWESKNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDENLYGPI    281 - 350
VKHISFFDFFKHKYQINIDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE    351 - 420
KLKWAKDHDEEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQEYANLQVSEPQIREGMKRVEPQTEDDLFP    421 - 490
CTCHRKKTKDEL                                                              491 - 502
//

Text Mined References (9)

PMID Year Title