Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $110,810.25
PubMed Score 2.67
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UW63 Q53HL3 Q9BVD2
Symbols EP58
ERp58
KDEL1

Gene

 Grant Application (2)

PDB

2DI7  

Gene RIF (1)

PMID Text
11167020 This paper reports data on mouse Kdelc1

AA Sequence

MFGTLLLYCFFLATVPALAETGGERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKV      1 - 70
FQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEIKFQGQHVAKSPYILKGPVYHENCDCP     71 - 140
LQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIPKRFGQRQSLCHYTLKDNKVYIKTHGEHVGF    141 - 210
RIFMDAILLSLTRKVKMPDVELFVNLGDWPLEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETM    211 - 280
GRVSLDMMSVQANTGPPWESKNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDENLYGPI    281 - 350
VKHISFFDFFKHKYQINIDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE    351 - 420
KLKWAKDHDEEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQEYANLQVSEPQIREGMKRVEPQTEDDLFP    421 - 490
CTCHRKKTKDEL                                                              491 - 502
//

Text Mined References (9)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635705 2005 Linkage disequilibrium analysis in the LOC93081-KDELC1-BIVM region on 13q in bipolar disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11167020 2000 Identification of a novel mammalian endoplasmic reticulum-resident KDEL protein using an EST database motif search.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.