Property Summary

NCBI Gene PubMed Count 21
PubMed Score 17.15
PubTator Score 93.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung adenocarcinoma 2,713

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 0.000

Synonym

Accession Q6UW60 Q8IY88 Q9UF79
Symbols PC4
SPC5

Gene

PANTHER Protein Class (3)

Gene RIF (4)

PMID Text
21080038 Maturation by propeptide removal occurs very inefficiently when rat or human proPCSK4 is overexpressed in HEK293 cells where it interacts with BiP.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16040806 abnormal processing of IGF-II by PC4 may represent a previously uncharacterized mechanism involved in the pathophysiology of fetoplacental growth restriction

AA Sequence

MRPAPIALWLRLVLALALVRPRAVGWAPVRAPIYVSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQY      1 - 70
FHLRHRGVVQQSLTPHWGHRLHLKKNPKVQWFQQQTLQRRVKRSVVVPTDPWFSKQWYMNSEAQPDLSIL     71 - 140
QAWSQGLSGQGIVVSVLDDGIEKDHPDLWANYDPLASYDFNDYDPDPQPRYTPSKENRHGTRCAGEVAAM    141 - 210
ANNGFCGVGVAFNARIGGVRMLDGTITDVIEAQSLSLQPQHIHIYSASWGPEDDGRTVDGPGILTREAFR    211 - 280
RGVTKGRGGLGTLFIWASGNGGLHYDNCNCDGYTNSIHTLSVGSTTQQGRVPWYSEACASTLTTTYSSGV    281 - 350
ATDPQIVTTDLHHGCTDQHTGTSASAPLAAGMIALALEANPFLTWRDMQHLVVRASKPAHLQAEDWRTNG    351 - 420
VGRQVSHHYGYGLLDAGLLVDTARTWLPTQPQRKCAVRVQSRPTPILPLIYIRENVSACAGLHNSIRSLE    421 - 490
HVQAQLTLSYSRRGDLEISLTSPMGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKG    491 - 560
YYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNH    561 - 630
TRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAAC    631 - 700
PHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT                   701 - 755
//

Text Mined References (23)

PMID Year Title
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
22679642 2012 The biology and therapeutic targeting of the proprotein convertases.
21805237 2011 The proprotein convertases, 20 years later.
21805236 2011 The prohormone theory and the proprotein convertases: it is all about serendipity.
21080038 2011 The precursor to the germ cell-specific PCSK4 proteinase is inefficiently activated in transfected somatic cells: evidence of interaction with the BiP chaperone.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19109312 Proprotein convertase subtilisin/kexin type 4 in mammalian fertility: a review.
18343183 2008 The activation and physiological functions of the proprotein convertases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...