Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.21
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.0e-07
atypical teratoid/rhabdoid tumor 1.100 2.7e-07
ependymoma 1.400 1.9e-16
glioblastoma 1.200 3.3e-08
Multiple myeloma 1.271 8.1e-04
non primary Sjogren syndrome sicca 1.200 2.8e-02
ovarian cancer -1.500 2.2e-05
pediatric high grade glioma 1.300 7.5e-08

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKG      1 - 70
TILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTI     71 - 140
TSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGAT    141 - 210
TLSVSILLWATQRRKAKTS                                                       211 - 229
//

Text Mined References (14)

PMID Year Title