Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.04
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q6UW56 A8C1S2 A8K779 Q96FF6 Q96RT2 Q9Y2R7 Q9Y5L7
Symbols p18
APR3
APR-3
APR--3
PRO240
C2orf28
HSPC013

Gene

Gene RIF (4)

PMID Text
23284715 The yeast two-hybrid screen identifies the HIV-1 Nef interacting human protein all-trans retinoic acid-induced differentiation factor (ATRAID; APR-3) in cells
23036366 APR3 expression is increased significantly with malignant progression of human cervical cervical squamous cell carcinoma (SCC), and thus, it may serve as a potential biomarker to predict prognosis of cervical SCC.
21723284 the effects of NELL-1 on osteoblastic differentiation and proliferation are partly through binding to APR3
17387583 These data suggested that APR3 might be functionally important in certain processes under which NFAT and/or NFkappaB are/is activated.

AA Sequence

MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKG      1 - 70
TILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTI     71 - 140
TSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGAT    141 - 210
TLSVSILLWATQRRKAKTS                                                       211 - 229
//

Text Mined References (14)

PMID Year Title
23036366 2013 Increased expression of apoptosis-related protein 3 is highly associated with tumorigenesis and progression of cervical squamous cell carcinoma.
21723284 2011 NELL-1 binds to APR3 affecting human osteoblast proliferation and differentiation.
18388313 2008 SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.
17524364 2007 Apoptosis related protein 3, an ATRA-upregulated membrane protein arrests the cell cycle at G1/S phase by decreasing the expression of cyclin D1.
17387583 2007 Identification of the distinct promoters for the two transcripts of apoptosis related protein 3 and their transcriptional regulation by NFAT and NFkappaB.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...