Property Summary

NCBI Gene PubMed Count 6
PubMed Score 42.54
PubTator Score 27.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis 4.007 0.000
atypical teratoid / rhabdoid tumor -1.300 0.009
glioblastoma -1.100 0.028
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.500 0.000

Synonym

Accession Q6UW49 Q8NG22 Q8WVH8 ESP
Symbols ESP
SP-ESP

Gene

Gene RIF (2)

PMID Text
17978344 human alloantigen involved in sperm-egg binding and fusion
12773409 Equatorial segment protein (ESP), a novel 349-amino acid concanavalin-A-binding protein encoded by a two-exon gene (SP-ESP) located on chromosome 15 at q22, has been localized to the equatorial segment of ejaculated human sperm.

AA Sequence

MKPLVLLVALLLWPSSVPAYPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIASK      1 - 70
GSKFKELVTHGDASTENDVLTNPISEETTTFPTGGFTPEIGKKKHTESTPFWSIKPNNVSIVLHAEEPYI     71 - 140
ENEEPEPEPEPAAKQTEAPRMLPVVTESSTSPYVTSYKSPVTTLDKSTGIGISTESEDVPQLSGETAIEK    141 - 210
PEEFGKHPESWNNDDILKKILDINSQVQQALLSDTSNPAYREDIEASKDHLKRSLALAAAAEHKLKTMYK    211 - 280
SQLLPVGRTSNKIDDIETVINMLCNSRSKLYEYLDIKCVPPEMREKAATVFNTLKNMCRSRRVTALLKVY    281 - 350
//

Text Mined References (7)

PMID Year Title
17978344 Equatorial segment protein (ESP) is a human alloantigen involved in sperm-egg binding and fusion.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12773409 2003 Equatorial segment protein defines a discrete acrosomal subcompartment persisting throughout acrosomal biogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.