Property Summary

NCBI Gene PubMed Count 6
PubMed Score 44.49
PubTator Score 27.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 8.8e-03
cystic fibrosis 4.007 3.2e-07
glioblastoma -1.100 2.8e-02
medulloblastoma, large-cell -2.000 2.6e-06
primitive neuroectodermal tumor -1.500 2.3e-04

Gene RIF (2)

AA Sequence

MKPLVLLVALLLWPSSVPAYPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIASK      1 - 70
GSKFKELVTHGDASTENDVLTNPISEETTTFPTGGFTPEIGKKKHTESTPFWSIKPNNVSIVLHAEEPYI     71 - 140
ENEEPEPEPEPAAKQTEAPRMLPVVTESSTSPYVTSYKSPVTTLDKSTGIGISTESEDVPQLSGETAIEK    141 - 210
PEEFGKHPESWNNDDILKKILDINSQVQQALLSDTSNPAYREDIEASKDHLKRSLALAAAAEHKLKTMYK    211 - 280
SQLLPVGRTSNKIDDIETVINMLCNSRSKLYEYLDIKCVPPEMREKAATVFNTLKNMCRSRRVTALLKVY    281 - 350
//

Text Mined References (7)

PMID Year Title