Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.82
PubTator Score 2.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.8e-43
cystic fibrosis 1696 7.7e-05
Atopic dermatitis 952 8.6e-04
diabetes mellitus 1728 4.5e-03

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 2.000 8.6e-04
cystic fibrosis -1.500 7.7e-05
diabetes mellitus 1.100 4.5e-03
psoriasis 3.400 2.8e-43

Gene RIF (2)

AA Sequence

MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG      1 - 70
NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS                                   71 - 110
//

Text Mined References (6)

PMID Year Title