Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.30
PubTator Score 2.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (2)

PMID Text
21454693 Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1.
19147602 The -1245 A-allele of the IGF1 promoter single nucleotide polymorphism is associated with a small head size and less brain sparing in small for gestational age born subjects

AA Sequence

MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG      1 - 70
NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS                                   71 - 110
//

Text Mined References (6)

PMID Year Title
21454693 2011 Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1.
19147602 2009 The -G1245A IGF1 polymorphism is related with small head size and less brain sparing in small for gestational age born children.
16890402 2006 IGFL: A secreted family with conserved cysteine residues and similarities to the IGF superfamily.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.