Property Summary

NCBI Gene PubMed Count 10
PubMed Score 22.39
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQK      1 - 70
RPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTI     71 - 140
LNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD                                       141 - 175
//

Text Mined References (12)

PMID Year Title