Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.97
PubTator Score 31.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Endometriosis -1.634 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.900 3.2e-03
non-small cell lung cancer -3.758 3.6e-12
pancreatic cancer 2.600 1.1e-05
spina bifida -2.328 3.9e-02

Gene RIF (3)

AA Sequence

MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARS      1 - 70
QHHVVCNT                                                                   71 - 78
//

Text Mined References (9)

PMID Year Title