Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.92
PubTator Score 31.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer -3.758 0.000
intraductal papillary-mucinous neoplasm ... 1.900 0.003
pancreatic cancer 2.600 0.000
Endometriosis -1.634 0.015
spina bifida -2.328 0.039

Gene RIF (3)

PMID Text
23094088 A novel secretory surfactant protein SFTA2 is expressed in different tissues (lung, eyelid, kidney, and testis)and possesses surface-regulatory properties.
22768197 SFTA2 was characterized as a novel unique secretory peptide highly expressed in the lung.
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARS      1 - 70
QHHVVCNT                                                                   71 - 78
//

Text Mined References (9)

PMID Year Title
23094088 2012 "SP-G", a putative new surfactant protein--tissue localization and 3D structure.
22768197 2012 SFTA2--a novel secretory peptide highly expressed in the lung--is modulated by lipopolysaccharide but not hyperoxia.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.