Property Summary

NCBI Gene PubMed Count 6
PubMed Score 516.10
PubTator Score 85.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -2.022 1.3e-03
adult high grade glioma 1.700 1.2e-02
Alzheimer's disease -1.500 1.6e-02
astrocytic glioma -2.000 9.3e-03
atypical teratoid / rhabdoid tumor -1.200 6.5e-03
Breast cancer 1.400 7.5e-03
chronic kidney disease 1.500 3.8e-02
cystic fibrosis 3.050 2.0e-07
ductal carcinoma in situ 1.100 3.9e-02
gastric carcinoma 1.500 3.3e-02
group 3 medulloblastoma -1.400 4.4e-02
interstitial cystitis -1.100 2.6e-02
interstitial lung disease 1.500 2.6e-02
intraductal papillary-mucinous adenoma (... -1.900 6.4e-03
intraductal papillary-mucinous carcinoma... -1.200 2.1e-02
intraductal papillary-mucinous neoplasm ... -2.200 2.0e-02
lung cancer -1.700 3.8e-03
lung carcinoma -2.400 2.7e-15
malignant mesothelioma -4.600 1.2e-07
medulloblastoma, large-cell -1.600 1.2e-02
oligodendroglioma -2.100 7.3e-03
ovarian cancer 2.300 1.3e-02
pancreatic cancer 2.500 1.2e-04
Pick disease -1.400 2.8e-03
posterior fossa group A ependymoma 1.500 1.2e-02
primary pancreatic ductal adenocarcinoma 2.657 1.7e-04
psoriasis 1.300 6.4e-39

Gene RIF (2)

AA Sequence

MCCWPLLLLWGLLPGTAAGGSGRTYPHRTLLDSEGKYWLGWSQRGSQIAFRLQVRTAGYVGFGFSPTGAM      1 - 70
ASADIVVGGVAHGRPYLQDYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDST     71 - 140
VRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQMFKI    141 - 210
PVFQEKHHVIKVEPVIQRGHESLVHHILLYQCSNNFNDSVLESGHECYHPNMPDAFLTCETVIFAWAIGG    211 - 280
EGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHT    281 - 350
IPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFN    351 - 420
FQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQL    421 - 490
QFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSI    491 - 560
QGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVCLLLLSCTLSTKSL                     561 - 613
//

Text Mined References (10)

PMID Year Title