Property Summary

NCBI Gene PubMed Count 6
Grant Count 20
R01 Count 10
Funding $3,173,314.21
PubMed Score 476.35
PubTator Score 85.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of monooxygenase, DBH-like 1 (MOXD1) in primary human brain microvascular endothelial cells
15337741 Based on its sequence and localization, MOX (monooxygenase X) is predicted to hydroxylate a hydrophobic substrate in the endoplasmic reticulum.

AA Sequence

MCCWPLLLLWGLLPGTAAGGSGRTYPHRTLLDSEGKYWLGWSQRGSQIAFRLQVRTAGYVGFGFSPTGAM      1 - 70
ASADIVVGGVAHGRPYLQDYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDST     71 - 140
VRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQMFKI    141 - 210
PVFQEKHHVIKVEPVIQRGHESLVHHILLYQCSNNFNDSVLESGHECYHPNMPDAFLTCETVIFAWAIGG    211 - 280
EGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHT    281 - 350
IPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFN    351 - 420
FQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQL    421 - 490
QFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSI    491 - 560
QGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVCLLLLSCTLSTKSL                     561 - 613
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337741 2004 Monooxygenase X, a member of the copper-dependent monooxygenase family localized to the endoplasmic reticulum.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9751809 1998 Identification and cloning of a sequence homologue of dopamine beta-hydroxylase.