Property Summary

NCBI Gene PubMed Count 6
PubMed Score 476.35
PubTator Score 85.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Obesity 616
Disease Target Count P-value
psoriasis 6685 6.40096578460798E-39
lung carcinoma 2844 2.70942458883102E-15
malignant mesothelioma 3163 1.16846546845506E-7
cystic fibrosis 1670 1.98355315178148E-7
medulloblastoma 1524 8.15106234701728E-6
lung cancer 4473 1.1266384277135E-5
pancreatic cancer 2300 1.1650226430702E-4
primary pancreatic ductal adenocarcinoma 1271 1.6587108226589E-4
adrenocortical carcinoma 1427 4.7948444679588E-4
Pick disease 1893 0.00105607653770382
interstitial cystitis 2299 0.00184845802765846
atypical teratoid / rhabdoid tumor 4369 0.0023279673218691
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00311565843167552
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00637261277833796
Breast cancer 3099 0.00752495458108392
oligodendroglioma 2849 0.00794422882084141
medulloblastoma, large-cell 6234 0.00880310119354736
astrocytic glioma 2241 0.00926477769523575
posterior fossa group A ependymoma 1511 0.0105690444958389
ovarian cancer 8492 0.0134906364196123
ductal carcinoma in situ 1745 0.0148456078011845
Alzheimer's disease 644 0.0160793339525417
adult high grade glioma 2148 0.0195432091409777
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0202983737908962
interstitial lung disease 292 0.0262286046650895
gastric carcinoma 832 0.0325527491286752
chronic kidney disease 90 0.0381320801475154

Expression

Synonym

Accession Q6UVY6 Q5THU6 Q8NC97 Q8WV49 Q9H4M6 Q9Y4U3
Symbols MOX
PRO5780
dJ248E1.1

Gene

  Ortholog (14)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of monooxygenase, DBH-like 1 (MOXD1) in primary human brain microvascular endothelial cells
15337741 Based on its sequence and localization, MOX (monooxygenase X) is predicted to hydroxylate a hydrophobic substrate in the endoplasmic reticulum.

AA Sequence

MCCWPLLLLWGLLPGTAAGGSGRTYPHRTLLDSEGKYWLGWSQRGSQIAFRLQVRTAGYVGFGFSPTGAM      1 - 70
ASADIVVGGVAHGRPYLQDYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDST     71 - 140
VRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQMFKI    141 - 210
PVFQEKHHVIKVEPVIQRGHESLVHHILLYQCSNNFNDSVLESGHECYHPNMPDAFLTCETVIFAWAIGG    211 - 280
EGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHT    281 - 350
IPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFN    351 - 420
FQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQL    421 - 490
QFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSI    491 - 560
QGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVCLLLLSCTLSTKSL                     561 - 613
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337741 2004 Monooxygenase X, a member of the copper-dependent monooxygenase family localized to the endoplasmic reticulum.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9751809 1998 Identification and cloning of a sequence homologue of dopamine beta-hydroxylase.